KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00034808G001Help
Entry
GSTEN00034808G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04010  MAPK signaling pathway
tng04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    GSTEN00034808G001
   04020 Calcium signaling pathway
    GSTEN00034808G001
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tng04040]
    GSTEN00034808G001
Ion channels [BR:tng04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   GSTEN00034808G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel
Motif
Other DBs
NCBI-ProteinID: CAG12515
UniProt: Q4RGG7
Position
18
AA seq 214 aa AA seqDB search
VPYPELVPVVFFCLKQTTCPRSWCIRMVSNPYPFVQKAKLSEETSRTAARVSIMVILLNC
MTLGMYQPCENIDCSSERCQILQAFDAFIYIFFALEMVVKMVALGIFGRRCYLGDTWNRL
DFFIVMAGMVEYSLDLQNINLTAIRTVRVLRPLKAINRVPSMRILVNLLLDTLPMLGNVL
LLCFFVFFIFGIIGVQLWAGLLRNRCYPEENFTL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
gtgccctaccctgagctggtaccggtggtcttcttctgcctgaaacagacgacctgcccc
cgcagctggtgcatccgcatggtctcgaacccatatccttttgttcagaaggcaaaatta
tcggaggagacatccaggacagcagctcgcgtcagtatcatggtcatcctgctgaactgc
atgaccctgggaatgtatcagccctgtgagaacatcgactgctcgtcagaacgatgtcaa
atactgcaggcttttgacgcgttcatttacattttcttcgctctggagatggtcgtaaag
atggtcgctctgggaatctttggccgcagatgttacctcggggacacgtggaaccggctg
gacttctttatcgtcatggccgggatggttgaatactcgctggacctacagaatatcaac
ttgacagccatcagaacagtgagggtcctgcggccgctcaaagcaatcaacagagtgccc
agcatgcgcatcctggtgaacctgctgctcgacaccttgccgatgctgggcaacgtcctc
ctcctctgcttctttgtcttcttcatctttggcatcatcggcgtacagctgtgggcgggg
cttctacggaaccgctgctacccagaggaaaacttcacactgtga

DBGET integrated database retrieval system