KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00034857G001Help
Entry
GSTEN00034857G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K14286  ethanolamine-phosphate phospho-lyase [EC:4.2.3.2]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00564  Glycerophospholipid metabolism
tng01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    GSTEN00034857G001
Enzymes [BR:tng01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.2  ethanolamine-phosphate phospho-lyase
     GSTEN00034857G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: CAG12551
UniProt: Q4RGD1
Position
undetermined
AA seq 353 aa AA seqDB search
NCSSEANDLALRLARHFTGHRDVITLDNAYHGHVSSLIDISPYKHHQLPDAERNPYVHVA
PSPDVYRGKYRADHPDAATAYADEVRDIIDRAHERGGKIAAFIAESLQSCGGQVVPPVGY
FQQVAAYVAQHVRRAGGVVIADEVQVGFGRVGSHFWAFQLQGDDFVPDIVTMGKPMGNGH
PLSCVVATPEVAEAFASCGMEYFNTVRPGPPPDTGLGLTPPWSPRNPPVWREPGVLRHRL
SRPGRHGERGPAGERRTCGATPDAPAGGAETEAPADRRRQGRGLFVGVELVKDRVTLAPA
TAEAQEVINRLKEEKILLSADGPHRNVLKFKPPLCFTAQDADLAVEKIDLVLT
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
aactgcagctcggaagccaacgacctggcactgcgcctggcgcgccacttcacgggccac
agagacgtcatcaccctggacaacgcctaccacggccacgtctcctcgctcatcgacatc
agcccctacaagcaccaccagctgcctgatgctgagcgcaacccctacgtgcacgtggct
cccagtccagatgtgtaccggggcaagtacagggccgaccacccggacgccgccaccgcg
tacgccgacgaggtcagagacatcatcgacagggcccacgagcgcggaggaaagatcgcc
gccttcatcgccgagtccctgcagagctgcggcggccaggtggtgcccccggtgggctac
ttccagcaggtggcggcgtacgtagcacaacacgtccgtagagccgggggcgtcgtcatc
gccgacgaggtccaggtgggcttcgggcgtgtgggcagccatttctgggccttccagctg
caaggagacgacttcgtccccgacatcgtcaccatggggaagccgatgggaaacggccac
ccgctgtcctgcgtggtcgccaccccggaggtggcggaggcctttgcctcctgcgggatg
gagtacttcaacacggtaagaccaggacctccgcccgacacaggcctgggcctgaccccg
ccctggtctcctcggaatcctccagtttggcgggaacccggtgtcctgcgccatcggctt
agccgtcctggacgtcatggagaaagaggacctgcaggggaacgccgcacgtgtggggcg
acacctgacgcgcctgctggcggagcagaaacagaagcacccgctgatcggcgacgtcag
gggcgtggcctctttgttggcgtggagctggtgaaggacagggtcacgctagcgccagca
accgcagaagctcaggaggtcattaataggctgaaggaggagaagatcctcctcagcgcc
gacggacctcatcgcaacgtgctcaagttcaagccgcccctgtgcttcacggcccaggac
gccgacctggcggtggagaagatagacctcgtcctcaca

DBGET integrated database retrieval system