KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00035870G001Help
Entry
GSTEN00035870G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K12567  titin [EC:2.7.11.1]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
KEGG Orthology (KO) [BR:tng00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tng01001]
    GSTEN00035870G001
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tng04131]
    GSTEN00035870G001
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:tng04812]
    GSTEN00035870G001
   04147 Exosome [BR:tng04147]
    GSTEN00035870G001
Enzymes [BR:tng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     GSTEN00035870G001
Protein kinases [BR:tng01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   GSTEN00035870G001
Membrane trafficking [BR:tng04131]
 Others
  Actin-binding proteins
   Others
    GSTEN00035870G001
Cytoskeleton proteins [BR:tng04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     GSTEN00035870G001
Exosome [BR:tng04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GSTEN00035870G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 ig Ig_2 Izumo-Ig Ig_4 V-set Ig_5 Ig_6
Motif
Other DBs
NCBI-ProteinID: CAG13291
UniProt: Q4RE91
Position
undetermined
AA seq 1216 aa AA seqDB search
MKPEEVKLKPFKKFAVPEEPEAEKKEKPDKDIAPFQKKERVPKEETKVKEQRRKPEKSPP
DEKEPQAKVPKPADKKISPESALEEAKAPAEIKKIPTQEQEMESVRLKPISVPSKVVGEP
EKKPLEKKDTKAVDDKQLHSRISVEKPKEQEPGLKQNKAEIPEAAEKKPEKTPEVKTVRE
EEKVHALPPSIEKLEKTPEEAKPLQLKKGVISKLKVEKEEVVLTPVKQLKKVQLKKTPSP
KVEKPKEAQPISVEKIPGRDKLKKVPITDTPKESAEAMKKVLKKSLPEEEKIAPPEKLDK
EKIPIVKEVSPGAVQMKKIATQPEEEVFEEEFGVEEEAVQEEGEVWGWELVPQESYGSED
WEGEGEDGALEVPGVTRRARQTPSPGEGRGRGLKPGGRGTPPPEEPFGGFKLKAVPLKFI
KKLQDIVLKEAESIGSSAVFECEVSPSTAVTSWMKDGGNLRESPKHKFTSDGKDRKLNII
DVQLSDTGEYTCVAKNAGKEISCMAKLIVEELPVKWIKELEEETSALKGQPLYVTCELNK
ERDVIWKKDGEVLKKKAGKIQINVIXTTARFELELSHENIPVTWYKNDAKIHPSRTVLTH
VDGKRHVLEIKEVTLDDTCQIKAEAKGIPSMANLTVIEGDAYFTVKLQDYTAVEKDKVVL
DCELNKDVDVMWYHNEAEIRPSKMVSIKADGKRRSLIISRVTDKDEGQYVCDCGTDKTSA
TLHIKARHIKVLRPMYGAEVFEGETARFEVELSEDDVHGQWSLNGELLSPSSDIEIVEDG
PKHTLVLYNCRVPQTGEVVFTAANAKCSANLKVKEIPISFITPLADVYVYEKDEARFELE
ISREPKNFRWLKGPQELVNDDKFELLVEGKKHILLIKSAKYEDEAKYTFEAEDKRTSGKL
FIQGIRLDFIKPIKDVTVKERETAEFSTELSHEKIPVVWYKNEVRLHPSKVVHITEDGKV
HMLAFKELTVDDTSMIKVEAMGKSSEAMLTVLEGDVYFTVKLQNYTAVEKDEAILSCELS
KATADVKWFKDGEEVFPSKNILIKSDGKKRMLVIKKAAKSSAGTYTCSCATDKTTSDLNI
EEREIKVVRPLYSVEVTETETAKFETEISERDIHATWKLKGETLHPSADVEIKEEGARHM
LILFNCKKDMAGGVDFLAANAKSSAQLRVKARIISLMRPLKDVTVTAGETATLSVSVYEG
IAVEWFLEGTKLEPSA
NT seq 3648 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccagaagaggtcaaactaaaaccatttaaaaagtttgcagtacctgaagagcca
gaggcagagaagaaagagaagccagacaaggacattgcaccttttcagaagaaagagagg
gtccccaaagaagaaaccaaagttaaagagcaacggaggaaacctgaaaaatctccacca
gatgaaaaggagccacaggccaaggtccccaagccagctgataaaaagattagtccagaa
tcagcactcgaggaagctaaagcaccagctgagatcaagaaaatcccaacacaggaacag
gagatggaaagcgttagactgaaacccatttctgtgccttcaaaagtggttggagaacct
gaaaagaaacctttagagaaaaaagacacaaaagcagtggatgataagcagcttcatagt
agaatttcagttgaaaaaccaaaagaacaagagccggggcttaaacagaacaaagctgag
attcctgaagctgctgagaagaagccagagaagacacccgaggttaagactgttcgggaa
gaggagaaggtacacgctctaccaccttccattgaaaaactagaaaagactcctgaagag
gccaagcccctgcaactgaagaagggagtcatatcaaagttaaaggttgagaaagaggag
gtagttctcacaccggtaaagcaactcaagaaggttcaactgaaaaagacaccatctccc
aaagttgaaaagccaaaagaagcacagccaatctctgttgagaagatccctggtcgtgat
aaactgaaaaaggttcctataacagatacacctaaagagtctgctgaagccatgaaaaag
gtccttaaaaagtccttaccagaggaggagaagattgcaccaccggaaaagctggataaa
gaaaagattcctattgtaaaggaggtttctccaggagcagtccagatgaaaaagatcgcc
actcagccagaggaggaggtgtttgaagaggagtttggagttgaggaagaggctgttcag
gaagagggagaggtctggggctgggagctggtccctcaggaaagttatggctctgaggac
tgggaaggtgaaggagaggatggtgctctggaggttccaggtgtgaccaggagagctcgt
cagaccccgtcccctggagaaggcaggggccgtgggctcaaacctggaggaagaggaacc
cccccgccagaggaacctttcggaggattcaaactaaaagctgtccctctgaagttcatc
aagaagctacaggacattgtgctgaaggaggctgagtcaattggctcgtctgctgtattt
gaatgcgaggtctcaccttccactgccgtcacatcatggatgaaagatggtggtaatctg
cgtgagagccccaagcacaagttcacctctgacggcaaagatcgaaaattgaacatcatt
gacgtccagctgtctgacaccggtgaatacacctgtgttgccaagaatgctgggaaggag
atatcgtgcatggccaagctcattgttgaagagttacctgtgaaatggatcaaagagctg
gaggaagaaacatcggcgctgaaggggcaaccgctatacgtgacctgtgagctgaacaaa
gaaagagacgttatctggaagaaggatggtgaggtcctgaagaaaaaggccggcaaaatt
caaatcaatgtcatcgncaccactgctcggtttgagctggaactttctcacgaaaacatt
cctgtaacttggtacaaaaatgatgccaaaattcacccgagcagaactgtgctcactcac
gtggacggaaagaggcatgtgctagaaataaaggaagtgactctggatgacacctgccaa
attaaggctgaggccaaaggaattccttccatggccaacctgacagtcatagagggagac
gcatactttacggttaaactccaggactatactgctgtggagaaggacaaggtggttcta
gattgtgagctcaacaaagacgtggatgtcatgtggtaccacaacgaggctgagatcagg
ccctctaagatggtctccataaaggctgatgggaagcggagatcgctcatcatcagcaga
gttacggacaaagacgaagggcagtatgtgtgtgactgtggaacggacaagacgtcagcc
acacttcacattaaagctcgccacatcaaggtgcttcggccgatgtatggcgccgaggta
tttgaaggagagacagctcggtttgaagtggagctgagcgaggacgatgtccatggacag
tggagcttgaatggagaacttctcagtccgtcctccgatattgagatcgtggaggacggg
cccaaacatactttggtcttgtacaactgcagagttcctcagaccggtgaggtggtcttt
actgccgccaatgccaaatgctcagctaacctgaaagtcaaggagatcccgatctcattc
atcacgccactggctgacgtgtatgtgtacgagaaggatgaagccaggtttgaactggaa
atctccagggaacccaagaacttccggtggctgaaggggcctcaggagctggttaatgat
gataaatttgaactcctggttgaaggaaagaaacacatccttctcataaaatcagccaaa
tatgaggatgaagccaaatacacctttgaagctgaagacaagagaacctctggaaaatta
tttattcaagggattcgtcttgatttcattaagcctatcaaagatgtaacagtgaaggag
cgggaaactgcagagttcagcaccgagctctcccacgagaagattccagttgtctggtac
aaaaacgaagtccgtctgcaccccagtaaagtggtgcacataacagaggatggaaaagtg
cacatgctggcttttaaggagctcaccgtagatgacacttccatgatcaaggtggaggcc
atgggcaagtcctcagaggccatgctcactgtgcttgaaggcgacgtgtacttcactgtc
aaactccaaaactacactgctgtggagaaagatgaggcgattttgtcctgtgagctcagt
aaagcaaccgctgacgtcaaatggttcaaagacggcgaggaagtcttcccctccaagaac
attctcatcaagtcagacggcaagaagcgtatgctggtcatcaagaaggcagcaaagagc
agcgctggcacctacacctgcagctgcgccacagacaaaaccacctctgacctgaacatc
gaagaacgagaaatcaaggtggttcgaccgctctacagcgtggaggtcaccgagacggag
acagccaaatttgagacggagatttcagagcgcgacattcatgctacctggaagctgaag
ggagagaccctccacccatccgctgatgtggagatcaaagaggagggagcccgacacatg
ttgatcctcttcaactgtaaaaaggacatggcaggaggtgtggacttcctggcagcgaat
gccaagtcatcagctcagcttagggttaaagcccgaatcatcagcctgatgaggcctctg
aaggatgtgacggtcacggcaggagagaccgctaccttgagtgtgagtgtctatgagggc
atcgctgttgagtggtttttggagggtacaaagctggaaccaagcgcg

DBGET integrated database retrieval system