KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00037488G001Help
Entry
GSTEN00037488G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K17724  aconitate decarboxylase [EC:4.1.1.6]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    GSTEN00037488G001
Enzymes [BR:tng01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.6  cis-aconitate decarboxylase
     GSTEN00037488G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MmgE_PrpD
Motif
Other DBs
NCBI-ProteinID: CAF87223
UniProt: Q4TIQ9
Position
undetermined
AA seq 135 aa AA seqDB search
RFHPPSVVGTMGSAAACARLLSLDQSQCSHALAIAASLSGAPMANAATQSKPLHIGNASR
LGLEAALLASRGLEASALILDDVDGVSGFGAFYEDYKPCSLESPTGKGHVFLLEDQDIGF
KLFPAHLGMHWVADA
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
aggtttcaccctcccagtgtggtgggaaccatgggcagtgcagccgcctgtgctcgtctc
ctgtccctggatcagtcccagtgcagtcatgctttggctatagctgcatccctgtctggg
gcaccaatggcgaatgctgccactcaatccaagcctctgcacattggtaacgcctcgcgt
ttggggctggaggctgctctgctggcctccaggggcctggaggccagtgctctgattctg
gatgatgtggatggggtttctggctttggtgctttttacgaagactataaaccctgctca
ttagaatccccaactggcaagggccatgttttcctgctcgaagaccaggacattgggttc
aagctcttccctgcccatctgggaatgcactgggtggcagatgct

DBGET integrated database retrieval system