KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00037625G001
Entry
GSTEN00037625G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    GSTEN00037625G001
Enzymes [BR:tng01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     GSTEN00037625G001
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF4012
Other DBs
NCBI-ProteinID: CAG14527
UniProt: Q4RAQ6
Position
undetermined
AA seq 244 aa
QSFHVLAGCLTEKGADDLKRVAGPNLKTVLLNVTSEESIQKAMEWAKKEWMRVEDFQRTL
KVNMSGVIAMTMTFLPLIKKARGRIVNVASVLGRVAANGGGYCISKFAVEGFSDCLRRDL
HYFGINVCIIEPGFFKTAVTSLEPLERELHRLWNQLSPEVQATYGDKYLDKYIKVQRLIM
NAVCDSDLTKVTGCMEHALTASHPRSRYSAGWDAKLLWIPLSYMPACVVDIGLKLVLPRP
LKSV
NT seq 735 nt   +upstreamnt  +downstreamnt
cagagtttccacgtgttggctggctgcctcaccgagaagggagccgacgacctgaagagg
gtggcgggccccaatctgaagaccgtcctgctgaacgtgaccagcgaggagagcatccag
aaagccatggagtgggccaagaaggagtggatgagagtggaggatttccagcgcacactc
aaagtcaacatgagtggagtgattgccatgaccatgaccttcctgcccctcatcaaaaag
gcccgcgggcgaatcgttaatgttgcctcagtgctgggcagggttgcggcaaacggaggt
ggatactgcatctccaagtttgcagtggagggtttctctgactgcctcaggagagatctg
cactactttggaatcaacgtctgcatcattgagccaggctttttcaagaccgcagtcacg
agcctggaacctctggagagggagctgcatcgcctgtggaaccagcttagccctgaagta
caggcaacatatggggacaagtacctggataagtacatcaaggtgcagcgcttgatcatg
aatgctgtctgtgactcggacctcaccaaggtgactggctgtatggagcacgctctgact
gcgtcccacccgcgctccaggtacagcgccggctgggacgccaagctcctctggatcccc
ctgtcctacatgcccgcctgtgtggttgacattgggctgaaactggtgctgccccgtcct
ttgaagagcgtttaa

DBGET integrated database retrieval system