KEGG   Thioalkalivibrio nitratireducens: TVNIR_1035Help
Entry
TVNIR_1035        CDS       T02408                                 

Gene name
pcaF_[H]
Definition
(GenBank) 3-ketoacyl-CoA thiolase; Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
tni00071  Fatty acid degradation
tni00280  Valine, leucine and isoleucine degradation
tni00310  Lysine degradation
tni00362  Benzoate degradation
tni00380  Tryptophan metabolism
tni00620  Pyruvate metabolism
tni00630  Glyoxylate and dicarboxylate metabolism
tni00640  Propanoate metabolism
tni00650  Butanoate metabolism
tni00900  Terpenoid backbone biosynthesis
tni01100  Metabolic pathways
tni01110  Biosynthesis of secondary metabolites
tni01120  Microbial metabolism in diverse environments
tni01130  Biosynthesis of antibiotics
tni01200  Carbon metabolism
tni01212  Fatty acid metabolism
tni02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TVNIR_1035 (pcaF_[H])
   00630 Glyoxylate and dicarboxylate metabolism
    TVNIR_1035 (pcaF_[H])
   00640 Propanoate metabolism
    TVNIR_1035 (pcaF_[H])
   00650 Butanoate metabolism
    TVNIR_1035 (pcaF_[H])
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TVNIR_1035 (pcaF_[H])
   00072 Synthesis and degradation of ketone bodies
    TVNIR_1035 (pcaF_[H])
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TVNIR_1035 (pcaF_[H])
   00310 Lysine degradation
    TVNIR_1035 (pcaF_[H])
   00380 Tryptophan metabolism
    TVNIR_1035 (pcaF_[H])
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TVNIR_1035 (pcaF_[H])
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TVNIR_1035 (pcaF_[H])
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    TVNIR_1035 (pcaF_[H])
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tni04147]
    TVNIR_1035 (pcaF_[H])
Enzymes [BR:tni01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     TVNIR_1035 (pcaF_[H])
Exosome [BR:tni04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TVNIR_1035 (pcaF_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGA32719
UniProt: L0DSX9
Position
956912..958240
Genome map
AA seq 442 aa AA seqDB search
MTTLTTGSGARPVYLVDGLRTPYLKVRDAPGAFRASDLAVAAGRALLLRQPLRATDLDEV
VFGCVASGPDEANIGRVIALRLGCGHRVPGWTVQRNCASGLQALDSAAKDIALGRADLVL
AGGTEAMSHHPVLYRPEMVAWLGRFSRTRGVWGRLRELARLRPSHLKPVIGLLRGLTDPV
VGLSMGQTAEVLAARFGIGRAEMDAFAVESHRRLGAAVDSGRMAPELVTLYHQGRIVDRD
DGLRPDSSLENLAKLHPAFDRPHGSVTAGNSAQITDGAACMLLASADAVERHGLVARARV
VDVAWAGLDPAQMGLGPAYAIERLLSRTGLEIPAIDYWEINEAFAAQVLACLRALVDPDF
CRSELGRDKPMVPIDPERLNVDGGAISLGHPVGSSGARITWHLLRTLEARRAQRGVASLC
IGGGQGGAVLLERTDAGVPGES
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgacgacactcaccacggggtcaggcgcacgcccggtctacctggtcgatggtttgcgc
actccctacctcaaggtccgcgacgcgccgggagcgtttcgcgcctcggacctcgcggtg
gctgcaggacgggcgctgttgctgcgccagccgttgcgggcgaccgatctcgacgaagtc
gtattcggttgcgtggcctctgggccggacgaggccaatatcgggcgcgtcatcgcgctg
cgccttggctgcggccatcgtgtacccggatggacggtacagcgcaactgcgcctccgga
ctccaggcgctggactccgcagccaaggatattgcgctggggcgggccgatttggtgctc
gccgggggtaccgaggcgatgagccatcacccggtgctgtaccgtccggagatggtggcc
tggctcggccgcttcagccggacgcgtggcgtatggggccggttgcgggaactggcgagg
ctgcgccccagccacctgaagccggtgatcggcctgctgcgcgggctgacggacccggtc
gtgggtctcagcatgggccagacggccgaggttctggctgcccgcttcgggattggccgt
gccgagatggatgcgttcgcggtggagagtcaccggcgtcttggcgctgcggtcgattcc
ggccggatggctccggaactcgtgacgctctatcaccagggtcggatcgttgaccgggac
gacgggctgcggcccgattcctcgctggagaacctcgcgaaactgcatcccgcgttcgac
cggcctcacggcagcgtcaccgcgggaaactcggcccagatcaccgacggggcagcctgc
atgctgctggcctcggcggacgcggtcgaacgccacggactcgttgcccgggcccgggtc
gtggatgtcgcctgggccggcctggaccccgcccagatgggtctcggccccgcgtatgcg
atcgagcggctgctgtcgcgtacggggctggaaatcccggcgatcgattactgggaaatc
aacgaggcgtttgcggcgcaggtgctggcctgtctgcgggccttggtcgacccggacttc
tgccgaagcgaactcgggcgggacaaacccatggtcccgatcgaccccgagcgtctgaac
gtcgacggtggtgcgatcagcctgggacatcccgtgggcagcagcggcgcgcggatcacc
tggcatctgctgcgcacgctggaggcgcgccgcgcgcaacgcggcgtggccagcctctgc
atcgggggcgggcagggtggtgcggtgctgctcgaacgaacagacgcgggcgtaccggga
gaatcctga

DBGET integrated database retrieval system