KEGG   Thioalkalivibrio nitratireducens: TVNIR_1444Help
Entry
TVNIR_1444        CDS       T02408                                 

Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
tni00020  Citrate cycle (TCA cycle)
tni00190  Oxidative phosphorylation
tni00650  Butanoate metabolism
tni01100  Metabolic pathways
tni01110  Biosynthesis of secondary metabolites
tni01120  Microbial metabolism in diverse environments
tni01130  Biosynthesis of antibiotics
tni01200  Carbon metabolism
Module
tni_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tni_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tni_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TVNIR_1444
   00650 Butanoate metabolism
    TVNIR_1444
  Energy metabolism
   00190 Oxidative phosphorylation
    TVNIR_1444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: AGA33114
UniProt: L0DU42
Position
1418627..1418965
Genome map
AA seq 112 aa AA seqDB search
MSLLGGQRAWLLQRVTAVYAGVYLLGAVALLLVRPPADHGAWLALVAHPAVWLATALFVL
VLLLHAWVGLRDVILDYLKPAWVRLTVLTLAAGVFLVMGFWALWILIDAVLR
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctgctgggcgggcagcgagcctggctgctgcagcgggtcaccgcggtctacgcg
ggcgtctacctgttgggcgcggtagcgttgctgcttgtgcgcccaccggcggatcacggt
gcctggctggcgctggtcgcgcatccggccgtttggctggccacggcgctgttcgtgctg
gtgctgctgctacacgcctgggtcgggctgcgtgacgtgatcctcgactacctgaaaccg
gcctgggttcggctcactgtgctgacgctggcggcaggagtcttcctggtgatggggttc
tgggccctgtggatcctgatcgacgcggtgctccgatga

DBGET integrated database retrieval system