KEGG   Thioalkalivibrio nitratireducens: TVNIR_2211Help
Entry
TVNIR_2211        CDS       T02408                                 

Gene name
apaG_[H]
Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
tni  Thioalkalivibrio nitratireducens
Brite
KEGG Orthology (KO) [BR:tni00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    TVNIR_2211 (apaG_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AGA33867
UniProt: L0DXZ8
Position
2244353..2244733
Genome map
AA seq 126 aa AA seqDB search
MSPTEHRVEIEVATAYIEEQSDPEASRFVFAYHITIRNTGEAAVQLLNRHWIIRDARDQT
QEVRGEGVVGKQPRIPPGEEFEYTSGTVLETPVGTMEGSYEMRDDSGFTFQAPIPPFTLS
IPHSLH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagccctacggaacaccgcgtcgagatcgaagtcgcaaccgcgtacatcgaagaacag
tcggatcccgaggcctcgcggttcgtgttcgcctaccacatcacgatccgcaatacgggt
gaggccgcggtccagctgctgaaccggcactggatcatccgcgacgcccgcgatcagacc
caggaagtgcgcggcgaaggtgtggtgggcaagcagccacggatcccgcccggagaggaa
ttcgaatacaccagcggcacggtgctcgagaccccggtcgggacgatggagggcagctac
gagatgcgcgacgattcgggtttcaccttccaggccccgatccccccgttcactctctcg
atcccccattcgctgcattga

DBGET integrated database retrieval system