KEGG   Thioalkalivibrio nitratireducens: TVNIR_2819Help
Entry
TVNIR_2819        CDS       T02408                                 

Gene name
yliJ_[H]
Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
tni00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    TVNIR_2819 (yliJ_[H])
Enzymes [BR:tni01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     TVNIR_2819 (yliJ_[H])
Transporters [BR:tni02000]
 Other Transporters
  Pores ion channels [TC:1]
   TVNIR_2819 (yliJ_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_N_4 Tom37 GST_C_3 GST_C_5
Motif
Other DBs
NCBI-ProteinID: AGA34457
UniProt: L0DZP1
Position
2910405..2911097
Genome map
AA seq 230 aa AA seqDB search
MALPHLHLISFPLCPFVQRSVITLKHKNIPFERTYLDPTALPDWFLEKSPTGKVPLLIVD
ERTALFESAAINEYLDEISPPRLLPEDPLERAQARAWIALASEMIAAQFRWMGAPTEEAF
GEARDEAAKGLRQFEKQCRAGPCFTGPDFSLLDATVAPVLMRYELLQDPGSPWQPAEFPN
LARWWQHISEMPAVRESVPDDFLARLPRFLTNQQGFAGPRLAAGLAERGH
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggcactgccccatctgcatctgatcagctttccgttatgtccgttcgtgcagcgtagc
gtcatcacgctgaaacacaagaacatcccgttcgaacggacctacctcgatcccaccgca
ctgccggattggttcctggagaaatcccctaccggcaaggtgccgctgctgatcgtagac
gaacgcaccgcgctgttcgaatcagcggcgatcaacgagtacctggacgagatctccccg
ccccggctgctgccggaagacccgctggaacgggcccaggcccgagcctggatcgctctc
gcatcggagatgatcgcggcccagttccgctggatgggcgcccccaccgaggaggccttc
ggcgaggcccgcgacgaggccgcgaagggtttgcgccagttcgagaaacagtgcagggcc
ggcccctgcttcaccgggcccgatttctcgctgctcgacgcgaccgtggcaccggtgctg
atgcgctacgaactgctgcaggatcccggcagtccctggcagccagccgagttcccgaac
cttgcgcgctggtggcagcacatctcggaaatgcccgcggtgcgcgagtccgtgcccgac
gatttcctggcacgcctgccgcgcttcctgaccaatcagcagggctttgccggaccacgc
ctggccgccggtctcgcggaacggggccactga

DBGET integrated database retrieval system