KEGG   Thioalkalivibrio nitratireducens: TVNIR_2951Help
Entry
TVNIR_2951        CDS       T02408                                 

Gene name
thrC_[H]
Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
tni00260  Glycine, serine and threonine metabolism
tni00750  Vitamin B6 metabolism
tni01100  Metabolic pathways
tni01110  Biosynthesis of secondary metabolites
tni01120  Microbial metabolism in diverse environments
tni01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TVNIR_2951 (thrC_[H])
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TVNIR_2951 (thrC_[H])
Enzymes [BR:tni01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TVNIR_2951 (thrC_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AGA34588
UniProt: L0DZV9
Position
complement(3044891..3046033)
Genome map
AA seq 380 aa AA seqDB search
MAFGHRYTGLIERYRDRLPVHDDTRIISLGEGNTPLIRLNNVPRHIGRDVELYVKFEGLN
PTGSFKDRGMTMAVTKAVEEGSKAIICASTGNTSASAAAYAARAGITAFVVIPDGKIAMG
KLAQAMMHGSVVIQIEGNFDDGMRLVKQVAESAPATLVNSVNPFRLQGQKTAAFEIVEEL
GRAPDYHCLPVGNAGNITAHWIGYCELSASSGEHVTEACTFCKGHCRFAGGGVAGQRPTM
VGYQASGSAPFLRGAMVDNPETVATAIRIGHPQSWNVAWKVQQESGGWFDECTDQEILAA
QKLLTEKEGVFCEPASAASVAGALRDIRTGRIPEGSSVVCTLTGHGLKDPDTAISQAGSA
PLKVAAELDAVTRTILDNMG
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggctttcggacaccgctataccggcctgatcgagcgttaccgcgaccgcctgccggtg
cacgacgacacccggatcatctcgctgggcgagggcaatacaccgctgatccggttgaac
aatgtcccgcgtcacatcggccgggatgtggaactctacgtgaagttcgagggcctgaac
ccgaccggctcgttcaaggaccgcggcatgaccatggcggtgaccaaggcggtggaggag
ggctcgaaagcgatcatttgcgcgtcgaccggcaacacctcggcgtccgcggcggcctac
gcggcgcgagcggggatcaccgcgttcgtggtgatccccgacggcaagatcgcgatgggc
aagctggcgcaggcgatgatgcacggatcggtggtgatccagatcgagggcaacttcgac
gacggcatgcgcctggtgaagcaggtcgccgagtccgccccggccacgctggtgaactcg
gtgaatccgttccggctccaggggcagaagaccgcggccttcgagatcgtggaggaactg
ggccgcgccccggattaccactgtctgccggtcggcaatgcaggcaatatcaccgcgcac
tggatcggctattgcgagctgtcggccagttcgggcgagcacgtgaccgaggcctgtacc
ttctgcaaggggcactgccgtttcgccggcggtggcgtcgccgggcagcgtccgacgatg
gttggctaccaggcgagcggcagcgcacccttcctgcgcggggcgatggtcgataatccc
gagacggtcgcgaccgcgatccggatcgggcacccgcagtcctggaacgtcgcctggaag
gtgcaacaggaatcgggcgggtggttcgacgaatgcaccgaccaagagatcctggcggcg
cagaagttgctgacggagaaggagggcgtgttctgcgagcccgcgtctgcagcctcggtt
gccggtgcgttgcgcgacatccggacgggccgcattcccgagggatccagtgtcgtctgc
acgctgaccggacacggcctgaaggatcccgataccgcgatctcccaggccggttccgcg
ccgctgaaggttgcggcggaactggatgcggtgacccggacgattctggacaacatgggc
tga

DBGET integrated database retrieval system