KEGG   Trichoplusia ni (cabbage looper): 113492561Help
Entry
113492561         CDS       T05757                                 

Definition
(RefSeq) myotubularin-related protein 2
  KO
K18081  myotubularin-related protein 1/2 [EC:3.1.3.64 3.1.3.95]
Organism
tnl  Trichoplusia ni (cabbage looper)
Pathway
tnl00562  Inositol phosphate metabolism
tnl01100  Metabolic pathways
tnl04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:tnl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    113492561
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    113492561
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tnl01009]
    113492561
Enzymes [BR:tnl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     113492561
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     113492561
Protein phosphatases and associated proteins [BR:tnl01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    113492561
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related GRAM DSPc Y_phosphatase Y_phosphatase3 3-PAP
Motif
Other DBs
NCBI-GeneID: 113492561
NCBI-ProteinID: XP_026725862
Position
4
AA seq 624 aa AA seqDB search
MDKHNSSELLNSDFSLSKNASSDSLDSDSKSSSLNSKHGQDSPHVLGDIHLLDGEKVMSV
ARDVTYLCPYSGPSRGVLKVTNYQLHFRPTDTAALQSTLSVPLGVVSRIEKVGGASSKGE
NSYGIEIFCKDMRNLRFAHKQENHSRRGIFEKLQQLAFPLSHRLPMFAFSYLETFPEDGW
LVYEPIAELRRMGVNNDMWRITRINDKYEVCDSYPSVWAVPAAANDDLLRAVATFRSRGR
IPVLAWIHPSSQATITRCSQPLVGVSGKRSREDERYIQLIMDANAQAHKLFIMDARPTAN
AVANKAKGGGYESEDAYQNADLVFLDIHNIHVMRESLRKLKELCFPQIDQSRWFSGIEAT
CWLKHIKCILAGAVRIVDKVENHKTSVLVHCSDGWDRTAQLTALAMLMLDPYYRTLRGFE
VLIEKEWLAFGHKFQLRIGHGDERHSDADRSPVFVQWVDCVWQLQQQFPTAFEFTERLLI
TIVDHLYSCRFGTFLFNTERERAKEEVKTKTVSLWSYINSRQELYLNPLYWGPAAGGGPA
SPAARPQLVLVPVASLRVIKLWKALYCRWNPTMRQQDPIYQRTRELVALRAQLEAAAAAA
AGDHAARQHRLGLTPPPAPSPHHV
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atggataaacacaacagttccgagctactgaattcagatttttcattatcaaaaaatgcc
agttccgattcattggactcagattctaaatcgagttcattgaattctaaacacggacaa
gactcccctcatgtactgggggacattcacttacttgatggggagaaggtgatgagtgtg
gctcgtgatgtcacttacttgtgcccctacagtggtccatcacgtggggtgctcaaagtc
acaaactatcagctgcatttcagaccaacagacactgcagcattacagagcactctcagt
gttcctcttggtgttgtatctcgcattgagaaagttggtggtgcttcatctaaaggcgaa
aactcatatggcattgaaatattttgcaaggacatgagaaacttaagatttgctcacaag
caagagaatcattctcgacgagggatattcgagaaactacaacagttagcatttcctcta
tctcatagattgccaatgtttgcattcagttatctagaaactttccctgaagatggatgg
cttgtttacgagcctattgctgagctgaggagaatgggtgtgaacaatgacatgtggcgg
attacacgcatcaacgacaagtatgaggtctgtgatagctatccgtcagtctgggccgta
cccgctgcagccaatgatgacctactgcgagccgtcgccacgttcaggtccagagggagg
ataccagtactagcgtggatacatcctagctcacaagccactataactagatgtagccag
cctttagttggggtaagcggtaagcgcagtcgcgaggatgagcggtacattcagcttata
atggatgctaatgcacaagcccataagctgttcattatggatgcgcggccaactgccaat
gccgttgctaataaagcaaaaggtggagggtatgagtcagaagacgcgtatcagaatgcc
gaccttgtgttcttagatatacacaacatacacgtcatgagagagagtctcagaaaactc
aaggagttgtgcttcccccaaattgatcagagccggtggttcagtggaatagaggcaact
tgttggctgaaacatataaaatgtatattggctggtgctgtccgaattgttgacaaggtt
gaaaatcacaaaacatcagtgttagtccactgctcagacggttgggaccgtacggctcaa
ctcacagcattggccatgctgatgctggatccctactacagaactctgagaggattcgaa
gtacttatcgagaaggaatggcttgccttcggacacaagtttcaattgcgtatcggccac
ggcgacgagcgtcactcagacgcggaccgctctcctgtgttcgtacagtgggtggactgc
gtgtggcagctgcagcagcagtttcccaccgccttcgagttcacagagagactgctcatc
actatagtggaccacctgtactcatgccgctttggaacattcctgtttaatacggagagg
gaacgggcgaaggaagaagtgaaaaccaagacggtatccctgtggtcgtacatcaacagc
cggcaggagctgtacctgaacccgctgtactggggcccggcggcgggcggcggccccgcc
tcgcccgccgcgcgcccgcagctcgtgctcgtgcccgtggcctcgctgcgggtcatcaag
ctgtggaaggccttgtactgtaggtggaaccccaccatgaggcaacaggaccccatctac
cagcgcacccgcgagctggtggcgctgcgcgcgcagctggaggcggcggcggcggcggcg
gcgggcgaccacgcggcgcgccagcaccgcctcggcctcacgccgccgcccgcgcccagc
ccgcaccatgtctga

DBGET integrated database retrieval system