KEGG   Trichoplusia ni (cabbage looper): 113493430Help
Entry
113493430         CDS       T05757                                 

Definition
(RefSeq) activin receptor type-2A-like
  KO
K13596  activin receptor type-2B [EC:2.7.11.30]
Organism
tnl  Trichoplusia ni (cabbage looper)
Pathway
tnl04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:tnl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    113493430
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tnl01001]
    113493430
Enzymes [BR:tnl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     113493430
Protein kinases [BR:tnl01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   113493430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Activin_recp APH Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 113493430
NCBI-ProteinID: XP_026727217
Position
4
AA seq 552 aa AA seqDB search
MVLMMASKILYLAVIIMFGSQVASAAPPSDENPPPRPKEGRVTTKYCEFFNGSQTSTCDT
SKNSTCVPDVIREECPPVEADKSNHCFVLWQVDNVTNTAYPKVKGCFVDTVSCTDRASNC
RLHYSKLPLLHCCCEGNMCNQNAVFPGIEAGIPSQTEVPPARVPASAVPSADDDTKAVIA
YTLTPLFLLFAILVGCYLLYRKRKGSSFAELANGEASLSRPPSAGAGMENEAVGLVGQVT
LCEVRARGRFGAVWRAKLGQRDVAVKVFPLQDKQSWLAEQEIFRLARMDHPDILHYIGVD
KKGDNLQAEYWLVTAYHEKGSLCDYLKGHTLTWVEAWRIAACVARGLAHLHEEGGGKPAV
AHRDFKSKNVLLKADLSACIADFGLALIFVAGRGCGDAHGQVGTRRYMAPEVLDGAINFT
KDAFLRIDMYACALVLWEIASRCTDAASDTPGQYRLPLEEEVGSHPSLEEMQEAVVQRKL
RPHIPPHWRNHPGLLVLCDTMEECWDHDAEARLSASCVLERVCAQQPASIAPALTPDTTP
LLIHELAEHQPC
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggttctgatgatggcttccaagatattgtacctcgccgtgataatcatgtttgggtct
caagtagcttcagcagctccgccctctgacgagaaccctcctccccggcccaaagaaggc
cgagtcaccaccaagtactgcgagttcttcaatggctcccaaacatcaacatgtgatacg
tcaaaaaattccacttgtgtccctgacgtcatcagggaagaatgtccaccggtggaagcc
gataagagcaaccactgctttgttctctggcaggtggataatgtcacgaatacagcatat
ccgaaggtaaaaggatgctttgtcgacacggtctcgtgcacggaccgcgcgtcaaactgc
cggctccactactcgaaactacccctgctccattgctgctgtgaaggaaatatgtgtaac
caaaacgcagtgttcccgggcatcgaagccgggatcccatcacagactgaagtcccaccc
gcccgagtgccagcatctgccgtccctagcgctgacgatgacacgaaagccgtcatagct
tacacgctaacaccactgttcctgctgttcgccattctcgtcggatgttacttgctgtac
agaaaacgtaaggggtcctcgttcgcggaactagcaaacggagaggcttcgttatctagg
ccgccgtctgccggcgccggcatggagaacgaagcggtcggtcttgtgggacaggttaca
ctgtgcgaggttagagctcgtggtcgattcggagccgtgtggagggcgaagcttggccag
cgtgacgttgccgttaaagtattccctttgcaagacaagcagtcgtggctggctgagcag
gagatcttccgtctcgctcgtatggatcacccggacatcctccactacattggcgttgac
aagaaaggcgacaatcttcaggctgaatattggctggtcactgcttaccatgaaaaggga
tcactttgcgactacttgaaaggtcataccctgacctgggtagaggcttggcgtatcgcg
gcgtgcgtcgcccgcggtctggctcacttacacgaggaaggcggtggcaaacctgccgtc
gcacaccgagacttcaagtccaagaacgtacttctgaaagcggacttgagcgcttgcatc
gcggactttggactggccctgatcttcgtagcggggaggggctgtggtgatgcccacgga
caagttgggacgaggaggtacatggccccggaagtcctggacggcgctatcaacttcacc
aaggatgcgttcttaaggatagacatgtacgcatgcgcactcgtgctctgggagatcgcg
tcaagatgcactgacgcagcatcagacacgcccggccagtaccggctgcctctagaagag
gaggtcggctctcaccccagtctggaagagatgcaggaggccgtcgtgcagaggaaactc
aggccacacataccgccgcattggaggaaccacccgggcctactagtgttatgtgacacg
atggaagaatgctgggaccatgacgctgaggctcgtctctcagcgtcgtgtgtgctggag
cgagtgtgcgcccagcagccggccagcatcgcgcccgccctcacccccgacaccaccccc
ctgctgatacacgaactggccgagcaccagccctgctga

DBGET integrated database retrieval system