KEGG   Trichoplusia ni (cabbage looper): 113493490Help
Entry
113493490         CDS       T05757                                 

Definition
(RefSeq) probable palmitoyltransferase ZDHHC24
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
tnl  Trichoplusia ni (cabbage looper)
Brite
KEGG Orthology (KO) [BR:tnl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    113493490
Enzymes [BR:tnl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     113493490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 113493490
NCBI-ProteinID: XP_026727291
Position
4
AA seq 280 aa AA seqDB search
MLLKLDSVKNKQYKRFLEHIFYIIIVLVLIPAFLYFEICVVLPAIVEQWSLAFFCHLVCA
TFLLQNIIGNMIYGMFTNTSIKGKKLESSSNEGWTLCSVCECLRPPRAWHCATCDICILK
RDHHCTFFACCVGYYNHRYFMLFTFYIFIAMVYSLYYNIKFAALFISWNNGLVLLRFICP
LASIVIDFGDESLYIFLLVINVIVGLFTGFLSFYHFNNIIKGRIVSETSAYTDDFIHNKG
WKLNMIEVFGDKWYMTWISPFILSRLPGNGITWFIENKSK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgaaactcgactccgtaaaaaataagcagtacaaaagatttttggaacatata
ttttatattattattgtcttagttctcattcctgcttttctttattttgagatatgtgtg
gtgttacctgcaatagtagagcaatggagtttagccttcttttgtcacttggtttgtgca
acattcctattgcaaaatattatagggaatatgatatatggaatgtttaccaacactagt
attaagggcaaaaagcttgaaagttcttctaatgaaggttggactctctgtagtgtatgt
gaatgtttgcgaccaccccgtgcctggcattgtgctacttgtgatatttgcatcctcaaa
agggaccaccactgtacattctttgcatgctgtgttgggtactacaatcatagatatttt
atgctctttaccttttacatatttattgctatggtttatagtctttattacaacattaaa
tttgctgctctgttcatctcttggaacaatggattagtattattgcgatttatatgccca
cttgctagtattgtcatagactttggagatgagagtctctatatttttttactagtcata
aatgtaatagttggcctctttactggatttctatctttttatcattttaataatataatc
aaaggaagaattgtttctgaaacaagtgcctacactgatgattttattcacaacaaaggc
tggaaacttaatatgattgaagtatttggagacaaatggtatatgacatggatttcacca
tttattcttagcagattaccaggaaatggtattacttggtttattgaaaataagagcaaa
taa

DBGET integrated database retrieval system