KEGG   Trichoplusia ni (cabbage looper): 113494610Help
Entry
113494610         CDS       T05757                                 

Definition
(RefSeq) glycine--tRNA ligase
  KO
K01880  glycyl-tRNA synthetase [EC:6.1.1.14]
Organism
tnl  Trichoplusia ni (cabbage looper)
Pathway
tnl00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:tnl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    113494610
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tnl01007]
    113494610
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tnl03016]
    113494610
   03029 Mitochondrial biogenesis [BR:tnl03029]
    113494610
Enzymes [BR:tnl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     113494610
Amino acid related enzymes [BR:tnl01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   113494610
Transfer RNA biogenesis [BR:tnl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    113494610
Mitochondrial biogenesis [BR:tnl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    113494610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HGTP_anticodon WHEP-TRS tRNA-synt_2b CarbopepD_reg_2
Motif
Other DBs
NCBI-GeneID: 113494610
NCBI-ProteinID: XP_026728833
Position
5
AA seq 732 aa AA seqDB search
MRNIVALVYKCSVFSKNFPIYCSQFRLTHNNYWGSNKLHRKIKIPNPQREIIMADPKIEE
ILAPLRACVKEQGDLVRKLKEEKAPEIDIKKAVAELKARKKVLEDKELSLAPSEELFDRA
KMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDCSI
LTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHLEKIKSEKNTTAELKAEIEDI
LVKLDGMTADEMSALMQRFQMKSPISGNDLTPPIEFNLMFNTQIGPSGLVKGFLRPETAQ
GIFVNFKRLLEFNQGRLPFAAAQIGNSFRNEISPRSGLLRVREFTMCEIEHFCDTKDHPK
FESVKDTQMLFYSANNQEQGKPAEIMTIGDAVSKGIVNNETLGYFMARIHLYMLAVGIDS
KKLRFRQHMGNEMAHYACDCWDAECLSSYGWVECVGCADRSAYDLTQHSKATGIRLAAEK
KLPAPKQIEVVEAVPNKAAIGKEFKKDAKVINDTLAAMDSAALDDLQAKLDANGEYTLST
PNGEFKLTPKIVSVKRTQKTVHVEEIIPSVIEPSFGIGRILYSILEHNFKMREGDEQRTY
FSLPAAVAPMKCAVLPLSGNAEFQPFVRELSQELTNVDVSHKVDDSSGSIGRRYARTDEL
GVPYAITVDFDTMKEPHSVTLRERDSMGQVRLPLTDVPVVVRDLSNSRISWSQIEQKYPK
FEQQETAKGAAA
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgagaaacatcgtagctttagtatataagtgtagtgtgtttagtaaaaactttccaata
tactgcagtcagtttcgactaactcataataactattggggcagcaataagctccacagg
aaaatcaaaatccccaatcctcaaagagaaataataatggctgatcctaaaattgaagaa
atcctcgcgcctttgcgggcctgtgtcaaagaacaaggtgatttagtccggaaactgaag
gaagagaaagcacctgaaattgacataaaaaaagctgtggctgagctaaaagcaaggaag
aaagtcttggaggacaaagaactcagcctcgcaccttctgaagagctttttgaccgtgcc
aagatggaggatctcattaaaagacgatttttctatgaccagtcctttgctatttatggt
ggcattactggtcaattcgacttcggccccatgggatgtgctctcaaaagcaacatgata
caactctggagaaaatactttattctccaagaacaaatgttagaggtggactgctctata
cttactcctgaaccagtactaaaagcttctggacatgttgagaggtttgctgaccttatg
accaaggatgttaagtctggagagtgcttccgtttagaccacttgatcaaagcccacctt
gaaaagataaagagtgaaaaaaatactacagcagagcttaaagcagagatagaagatatt
cttgtgaagcttgatggtatgacagctgatgagatgtcagcacttatgcaaaggttccag
atgaagtcacccatcagtggcaatgaccttactccaccaattgaatttaaccttatgttc
aacacccaaattggtcctagtggattagtgaaaggtttcctgagaccagaaacagctcaa
ggcatatttgtgaacttcaagcgtcttctggaattcaaccagggccgtctaccatttgca
gctgctcaaattgggaactccttcagaaatgaaatctcaccccgttctggtcttcttcga
gttagagagttcactatgtgtgaaattgagcacttctgtgacaccaaagatcatcctaag
tttgagtctgtgaaggacacacagatgctgttttactcagccaataaccaggagcaaggc
aaacctgctgaaatcatgactattggagacgctgtatctaagggcattgtcaacaatgag
actttgggatacttcatggccagaattcatttgtatatgctagctgttggcattgactcc
aagaaactaaggttcaggcagcatatgggtaatgaaatggctcactatgcctgtgactgt
tgggatgctgagtgtctctccagctatggatgggtggagtgtgtgggctgtgccgacagg
tctgcctatgacttgactcagcactctaaagctactggtatcagacttgctgctgaaaaa
aaactgccagctcccaaacagattgaagtagttgaagctgttcccaacaaagcagcaatt
ggcaaggaattcaagaaagatgcaaaagtcatcaatgataccttagcagcaatggactct
gcagccctagatgatctgcaagctaaattagatgccaatggggaatacaccctgtctaca
cctaatggtgaattcaaactaactcctaaaattgttagtgtgaaaagaactcaaaagaca
gttcatgttgaagaaatcattcccagtgttattgaaccttcatttggcattggtagaatc
ttgtatagcattttagaacacaacttcaaaatgagggagggtgatgaacagaggacttac
ttctcgttgccagccgcagtcgcgcctatgaagtgcgccgtcttgccactgagtggtaac
gccgaattccaaccatttgttagggaactatcccaagagttaacaaatgttgatgtttcg
cacaaagttgacgactcttctggatcaataggtcgtcgttacgctagaactgatgaactt
ggtgtcccatatgccattacagttgatttcgacaccatgaaagaacctcattcagttacc
cttagagaaagggatagtatgggccaagtaagattgcctttgactgatgttcctgttgtt
gtacgtgatctatctaacagcaggatctcctggtcgcaaattgagcagaagtatcccaag
tttgagcagcaagagactgccaagggcgccgccgcataa

DBGET integrated database retrieval system