KEGG   Trichoplusia ni (cabbage looper): 113495149Help
Entry
113495149         CDS       T05757                                 

Definition
(RefSeq) nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
tnl  Trichoplusia ni (cabbage looper)
Pathway
tnl00760  Nicotinate and nicotinamide metabolism
tnl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tnl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    113495149
Enzymes [BR:tnl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     113495149
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     113495149
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 113495149
NCBI-ProteinID: XP_026729558
Position
6
AA seq 268 aa AA seqDB search
MSYGKIVLMACGSFSPPTYMHLRLFELAKDYIHSLNLGNVVGGLVSPVHDAYGKKDLVAA
HHRISMLKLALRTSSWIKISEWETQQAGWTRTRISMQYHEDMINNFVTSGNHTEPPSWLP
DDVINLNSIDEPDNLMEKLNGNEEGRGGVTVKLLCGADLLESFATPGLWSDEDLETIVGR
HGLVVVSRAGSDPGRFIYESDMLYKHRKNVLIVTNYVANDVSSTVVRRLLRRGESAKYLT
DDAVLAYARAHTLYGQRACDTEAAARCS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacggaaagattgttttgatggcttgcggcagtttcagcccgccgacgtatatg
cacctccggttgttcgaacttgcaaaagattatattcactctctgaacttggggaatgtt
gtgggaggcctggtgtctccggtacatgatgcttatggaaagaaagatttggtagcagcg
caccacagaatatcaatgctgaagctagctttacggacgtcgtcgtggatcaagatatca
gaatgggagacacagcaggccggctggacgagaaccaggatatccatgcagtatcatgag
gacatgataaacaacttcgtaacatcaggcaaccatacagagccgccatcttggttgccg
gatgacgtcatcaacctgaacagtatcgacgagccggacaacctaatggagaagctgaat
ggtaacgaggagggtcgcgggggggtgacggtgaagctgctatgcggggctgatctgctg
gagtcgtttgcgacgcctggactgtggtcggatgaggatttggagacgatagtgggtcgc
cacgggctggtggtggtgtcccgcgccggcagcgaccccgggcggttcatatacgagtcc
gacatgctctataaacataggaaaaacgtgttaatagtaacaaactacgtggccaacgac
gtgagttcgacggtagtccggcgcctgctgcggcgcggcgagagcgccaagtacctcacg
gacgacgccgtgctggcctacgcgcgcgcgcacacgctgtacgggcagcgcgcctgcgac
acggaggcggctgcccgttgtagctga

DBGET integrated database retrieval system