KEGG   Trichoplusia ni (cabbage looper): 113495560Help
Entry
113495560         CDS       T05757                                 

Definition
(RefSeq) heat shock protein 68-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
tnl  Trichoplusia ni (cabbage looper)
Pathway
tnl03040  Spliceosome
tnl04141  Protein processing in endoplasmic reticulum
tnl04144  Endocytosis
tnl04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:tnl00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    113495560
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113495560
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113495560
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    113495560
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tnl01009]
    113495560
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:tnl03041]
    113495560
   03009 Ribosome biogenesis [BR:tnl03009]
    113495560
   03110 Chaperones and folding catalysts [BR:tnl03110]
    113495560
   04131 Membrane trafficking [BR:tnl04131]
    113495560
   03051 Proteasome [BR:tnl03051]
    113495560
   03029 Mitochondrial biogenesis [BR:tnl03029]
    113495560
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tnl04147]
    113495560
Protein phosphatases and associated proteins [BR:tnl01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     113495560
Spliceosome [BR:tnl03041]
 Complex B
  Other components
   Prp19 complex
    113495560
 Complex C
   Prp19-CDC5 complex
    113495560
Ribosome biogenesis [BR:tnl03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    113495560
Chaperones and folding catalysts [BR:tnl03110]
 Heat shock proteins
  HSP70 / DNAK
   113495560
Membrane trafficking [BR:tnl04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    113495560
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    113495560
Proteasome [BR:tnl03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    113495560
Mitochondrial biogenesis [BR:tnl03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    113495560
Exosome [BR:tnl04147]
 Exosomal proteins
  Proteins found in most exosomes
   113495560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C StbA Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 113495560
NCBI-ProteinID: XP_026730124
Position
7
AA seq 657 aa AA seqDB search
MPAVGIDLGTTYSCVGVWQHGNVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNP
NNTVFDAKRLIGRKFDDHKIQQDMKHWPFKVINDCGKPKIQVEFKGETKRFAPEEISSMV
LTKMKETAEAYLGASVRDAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAALAY
GLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVRATAGDTHLGGEDFDNRLVNHLT
EEFKRKYKKDLRGNSRALRRLRTAAERAKRTLSSSTEATIEIDALYEGIDFYTRVSRARF
EELCADLFRGTLDPVEKALKDAKMDKSQIHDVVLVGGSTRIPKVQALLQNLFCGKKLNLS
INPDEAVAYGAAVQAAILSGEQDAKIQDVLLVDVSPLSLGIETAGGVMTKIIERNSKIPC
KQSQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGTFDLTGIPPAPRGVPKIDVTFDMDA
NGILNVSAKENSTGRSKNIVIKNDRGRLSQSEIERMLAEAERYKDEDEKQRKRVAARNQL
EAYVFSVKQALDEAGDKLSEQAKGAARAACEDALRWLDNNSLADTDEYEHKLRELTQLCS
PIMTKIHTGGAGAAPGGGMPGGYPGGMPGGMPGGMPGGMPGGYQQGGYGGPTVEEVD
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgccagctgtaggaattgatttgggaacgacgtactcgtgcgtcggcgtgtggcagcac
gggaatgtggagatcatcgccaacgaccagggcaaccgcaccacgccgtcgtatgtggcg
ttcacagacacggagcggctcatcggcgacgcggccaagaaccaggtggccctgaacccc
aacaacacggtgttcgacgccaagcgactgatcggcaggaagttcgacgaccacaagatc
cagcaggacatgaagcactggcctttcaaagtgatcaacgactgcggcaagccaaagatc
caagtggagttcaagggagagacgaagcggttcgcacccgaggagatcagcagcatggtg
ctgacgaagatgaaggagacggcggaagcgtacctcggggcgagcgtgcgggacgcggtg
atcacagtgccggcgtacttcaacgactcgcagcggcaggccaccaaggacgcgggcgcc
atcgccgggctgaacgtgctgcgcatcatcaacgagcccacagccgccgcgctcgcctac
gggctcgacaagaacctcaagggcgagcgcaacgtgctcatcttcgacctcggcggcggc
actttcgacgtgtccatccttaccatcgacgagggctcgctgttcgaggtgcgcgcgaca
gccggcgacacacacctcggcggcgaggacttcgacaaccggctggtgaaccacctcacg
gaggagttcaagcgcaagtacaagaaggacttgcgcggcaactcgcgcgcactgcgccgg
ctgcgcaccgccgccgagcgcgccaagcgcacgctctcgtccagcaccgaggccaccatc
gagatcgacgcgctctacgagggcatcgacttctacacgcgggtgtcgcgcgcgcgcttc
gaggagctgtgcgccgacctgttccgcggcacgctcgaccccgtcgagaaggctctcaag
gacgccaagatggacaagagccagatccacgacgtggtgctcgtcggcggctccaccagg
atccccaaggtgcaggcgctcctgcagaacctgttctgcggcaagaagctgaacctgtcc
atcaaccccgacgaggcggtggcgtacggcgcggccgtgcaagccgccatcctgagcggc
gagcaggacgccaagatccaggacgtgctgctggtggacgtgtccccgctgtcgctcggc
atcgagaccgccggcggcgtcatgaccaagatcatcgagcgcaactccaagatcccctgc
aagcagtcgcagacgttcaccacgtactcggacaaccagccggcggtcacgatccaggtg
tacgagggcgagcgcgccatgaccaaggacaacaacctgctgggcacgttcgacctgacc
ggcatcccgccagcgccgcgcggcgtgcccaagatcgacgtcaccttcgacatggacgct
aacggcattctgaacgtgtccgccaaggagaacagcaccgggcgcagcaagaacatcgtg
atcaagaacgaccgcggccggctgtcgcagagcgagatcgagcgcatgctggccgaggcg
gagcgctacaaggacgaggacgagaagcagaggaagcgcgtggcggcgcgcaaccagctg
gaggcgtacgtgttcagcgtgaagcaggcgctggacgaggcgggcgacaagctgtccgag
caggccaagggcgcggcgcgggccgcctgcgaggacgcgctgcgctggctggacaacaac
tcgctggccgacacggacgagtacgagcacaagctgcgtgagctcacgcagctctgctcg
cccatcatgaccaagattcacacgggtggagcgggcgccgcgccgggaggcggtatgcct
gggggctatccgggaggaatgcccggaggcatgcccggaggaatgcccggagggatgccc
ggcggctaccagcagggcggctacggcggacccaccgtcgaggaggtcgactga

DBGET integrated database retrieval system