KEGG   Trichoplusia ni (cabbage looper): 113496719Help
Entry
113496719         CDS       T05757                                 

Definition
(RefSeq) autophagy-related protein 16 isoform X1
  KO
K17890  autophagy-related protein 16-1
Organism
tnl  Trichoplusia ni (cabbage looper)
Pathway
tnl04136  Autophagy - other
tnl04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:tnl00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113496719
   04136 Autophagy - other
    113496719
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tnl04131]
    113496719
   03029 Mitochondrial biogenesis [BR:tnl03029]
    113496719
Membrane trafficking [BR:tnl04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    113496719
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    113496719
Mitochondrial biogenesis [BR:tnl03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    113496719
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A MPS2 DUF4201 FAM76 FliM LRRFIP Nup160 Lebercilin PKcGMP_CC LURAP FUSC HOOK 5_nucleotid
Motif
Other DBs
NCBI-GeneID: 113496719
NCBI-ProteinID: XP_026731835
Position
8
AA seq 573 aa AA seqDB search
MNYKIKMEGSGWRSNIVSQLQARNKCETVAFQDIISFQSRLFDNVNTLKNENLQLTLLNE
RIRFTGTDSVLSGTGTANNERIQALEQKILIQQEELTSMHRRRGENAQQIMSLNEKVHEL
EKQLQAKDIVISETTAVIASLRAEIQMYETNMAELQGLNQVLRDEHQALQIAFASIEEKL
RKAQDENRSLVERLIKYKAKDADKMNEENEHFLKSSNPTAFFINTFGRVSFGKKSDKVRK
ELEEAARESGSRSSGSGSSEDKILESMPFYATVLPNKVALRFDAHDGEVNAVKWSPTDRI
VATGGADRKVKLWDVTKSMVESRGTLVGSNAGVMSVDFDATGAYIVGASNDFASRVWTVA
DQRLRHTLTGHSGKVMAAKFLGEPTKVITGSHDRTLKIWDLRSKMCTETKFAGSSCNDLV
TSDGAGSTIISGHFDKRIRFWDIRTEMSANDIMLQGKVTSLDLSRDNNYLLACVRDDTIQ
LIDLRMNTIVRSFSHESFKVGCDWSRAAFGPGGRLLSVGAADGAAYVWNTHSGRLETILK
DHTSAVTAVSWHPQSGLLASVDRGKRAIIWGDL
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgaactataaaataaaaatggaaggtagtggttggagaagcaacattgttagccaattg
caggctagaaataaatgcgaaactgtggcttttcaggacataatatcttttcagagcaga
ctgtttgataatgtgaatacattaaagaatgaaaacctgcaattaacgttattgaatgaa
agaatacggtttacgggaacagatagcgtgttatcaggcaccggaactgccaacaatgaa
aggattcaggctttggaacaaaaaattcttatccaacaagaagaactcacatctatgcac
agacggagaggagagaatgctcaacagataatgagtctcaatgagaaagtgcatgagtta
gagaaacaattacaagcaaaagatatagtaatttcagaaacaactgctgtcatagcatcc
cttcgtgctgaaatacaaatgtatgaaacaaatatggctgaattgcaaggactcaatcaa
gttttaagagacgagcatcaggcattacaaattgcttttgcatcaatagaagagaaatta
aggaaagcacaggacgaaaatcggtcgttagtggagagacttataaagtacaaagctaaa
gatgcggataaaatgaatgaagaaaatgaacatttcctcaagtcaagcaaccctaccgcg
tttttcatcaacacgtttggtagagttagtttcggaaagaaaagtgataaggtgcggaaa
gaactggaggaggcggctagagaaagtggtagccggagtagtggctcaggcagctctgag
gacaagatactggagtcgatgcctttttacgcaactgttctacctaataaggttgcattg
agatttgatgctcatgatggcgaagtcaatgctgtgaaatggagtccgacggacagaatc
gtggcgacaggcggtgccgatagaaaagtcaaattgtgggatgttactaaaagtatggtc
gaaagcaggggtacattagtcggttctaacgctggcgtcatgtcagtagacttcgatgcg
acgggagcgtacatcgtaggagcttcgaatgacttcgcgagtcgcgtgtggacagtcgcc
gatcagagattaaggcacacgttgacgggtcacagtgggaaagtaatggctgctaaattc
ctcggggagccaaccaaagtcattacgggaagccacgaccgaacgctcaaaatatgggac
cttagaagtaaaatgtgtacagagacaaagtttgcgggatcatcgtgtaatgacctggtg
acgtcagacggggcgggctccacgatcatatcgggacactttgacaagaggatcagattt
tgggacatccgcacagaaatgtccgcgaatgacatcatgctgcaaggcaaagtcacgtcg
ctggatctcagtagagataacaattatctgctggcgtgcgtccgtgatgacacaatacag
ctaatagatctcaggatgaacacaatcgtccgttccttcagtcacgagtcgttcaaggtg
ggttgcgactggtcgcgcgcggcgttcggtccgggcgggcgcctgctctccgtcggcgcg
gcggacggcgcggcctacgtgtggaacacgcactccgggcgactggagaccatactcaaa
gatcatacgtcggcagtgacggcggtgtcctggcatcctcagtctggtttgctggcgtca
gtggaccgcggcaagcgcgccataatatggggagatttgtga

DBGET integrated database retrieval system