KEGG   Trichoplusia ni (cabbage looper): 113496753Help
Entry
113496753         CDS       T05757                                 

Definition
(RefSeq) probable ATP-dependent RNA helicase pitchoune
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
tnl  Trichoplusia ni (cabbage looper)
Brite
KEGG Orthology (KO) [BR:tnl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:tnl03041]
    113496753
   03009 Ribosome biogenesis [BR:tnl03009]
    113496753
Enzymes [BR:tnl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     113496753
Spliceosome [BR:tnl03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    113496753
Ribosome biogenesis [BR:tnl03009]
 Eukaryotic type
  90S particles
   Helicases
    113496753
  Pre-60S particles
    113496753
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 AAA_30
Motif
Other DBs
NCBI-GeneID: 113496753
NCBI-ProteinID: XP_026731876
Position
8
AA seq 618 aa AA seqDB search
MPTPDKILMRKIKNREKKKLKLIKKKTNDASEETPEVENKPVKEVKKRPREDNEKAVPTK
KQKKVKKEIKTEPDPVKEEPSSENSGSDSDDEEIAESGAENNDNSESQLPGSSLCLGILS
DQKFTALEGKVCESTLMGIKDMGFTTMTEIQSKAIPHLLEGRDLVGAARTGSGKTLAFLI
PAIDLIYKLKFKPRNGTGVIILSPTRELAMQTFGVLMELMKYHHHTYGLVMGGANRSTEA
QKLSKGINILVATPGRLLDHLQNTPDFLYKNLQCLVIDEADRILEIGFEEEVKQIIKLLP
KRRQTMMFSATQTKKIEALTALAVKHEPVYVGVDDHREQATVDSLEQGYIVCPSEKRMMV
LFTFLKKNRKKKVMVFFSTCMSVKYHHELFNYIDLPVMSIHGKQQQTKRTTTFFQFCNAE
SGILLCTDVAARGLDIPAVDWIVQYDPPDDPKEYIHRVGRTARGLGTSGHALLFLRPEEL
GFLRFLKQSKVTLNEFEFSWNKIADIQLQLEKLISRNYFLNQSAKEAFKSYLRAYDSHHL
KTIFDIDTIDMAKVSKSFGFTVPPAVELKVASKGPPQKRKGGGGYGYFKSLNAPNNFKQK
AEKTKMYRQKGNNKRNNS
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgcctactccagacaaaatacttatgcgaaagattaagaatcgtgaaaagaagaagttg
aagcttataaaaaagaaaactaatgatgcatccgaagaaacaccagaagttgaaaacaaa
ccagtaaaagaggtaaagaaaaggccacgtgaagacaatgaaaaggcggtaccaactaaa
aaacaaaagaaggtaaagaaagaaatcaaaactgaaccagatccggtgaaagaggaacca
tcttcagagaacagtggttctgattctgacgatgaagaaattgctgaaagtggagctgaa
aataatgataactctgagagccaattgcccggttccagtttatgcctcggcatattatca
gatcaaaaattcactgcacttgaagggaaagtctgtgaatccactttgatggggattaag
gacatgggattcaccaccatgacagagatccagtctaaagctataccacatttacttgaa
ggcagggatctagtaggagcagctaggacaggatcgggaaaaactctggctttcttaata
ccagctattgatcttatttataaactgaagtttaagcctaggaatggtactggagtgata
atcttgtctcctacaagagaattggccatgcaaacatttggagtattaatggaattaatg
aagtatcatcatcatacttatgggttggttatgggaggtgctaatagaagtactgaagca
caaaagctttctaaaggtatcaacatcctagtggctacaccaggtcgacttttagatcat
ttgcagaacacaccagattttctttacaagaatttgcaatgtcttgtcattgatgaagct
gacaggatcttggagattggtttcgaagaagaagttaagcagatcattaaacttcttcca
aaacgtcgtcaaaccatgatgttcagtgccacacagacgaagaagattgaggctttgacg
gcgctagcggtaaaacacgaaccagtttacgtaggagtggatgaccatagagaacaggct
accgttgactctctagaacaaggttacattgtatgcccctctgagaagcgaatgatggtg
ttattcacattcctaaagaagaataggaagaaaaaggtcatggttttcttctcaacctgc
atgtcagtcaaatatcatcatgagctgttcaattacattgatctacctgtcatgtctatc
cacggcaagcaacaacaaacgaaacgtacgacaaccttcttccaattctgcaacgccgag
tccggtatactactgtgtacggatgtagcggccagaggcctggatataccagcggtcgac
tggatcgtacagtacgacccgccagatgatcctaaggaatatatccatcgcgtcggcaga
actgcacgaggtcttggaactagtggccacgcattactgtttcttcgccctgaagagctt
ggtttcctcaggttcttgaaacagtccaaggttacgctcaatgagttcgagttttcttgg
aataagattgcagatatacagctacagctcgagaagttgatatcaagaaactacttctta
aaccagtctgcaaaggaagcgtttaagagttacttgagggcctacgattcacatcatctc
aagacaatattcgatatcgacaccatcgatatggctaaagtgtccaagtctttcggtttt
acggtcccacccgccgttgaactgaaagtagcaagcaaaggacccccgcagaagaggaaa
ggaggcggcggatacggatacttcaaatcattaaacgcccccaacaacttcaaacaaaag
gcagagaaaactaaaatgtacaggcagaaaggcaacaacaaaagaaataacagctag

DBGET integrated database retrieval system