KEGG   Trichoplusia ni (cabbage looper): 113497820Help
Entry
113497820         CDS       T05757                                 

Definition
(RefSeq) arginine--tRNA ligase, cytoplasmic
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
tnl  Trichoplusia ni (cabbage looper)
Pathway
tnl00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:tnl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    113497820
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tnl01007]
    113497820
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tnl03016]
    113497820
   03029 Mitochondrial biogenesis [BR:tnl03029]
    113497820
Enzymes [BR:tnl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     113497820
Amino acid related enzymes [BR:tnl01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   113497820
Transfer RNA biogenesis [BR:tnl03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    113497820
 Prokaryotic Type
   Other AARSs
    113497820
Mitochondrial biogenesis [BR:tnl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    113497820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 113497820
NCBI-ProteinID: XP_026733378
Position
9
AA seq 683 aa AA seqDB search
MAEQEQKNLEERTIRAEKDAKAIEEELDKISKGDLSYIGDPRLEKLYSENEKLKHRLVIL
ENAIKAESSGSQKPAVSKEKKLPTLITDINSVEGNICIVDELKNIFEFAIGSAYPDLEDP
PIVITLSGNNPKFGDYQCNSAMPISQLLKAKNIKSNPREVANNILNKTPSSPFIERIEVA
GAGFLNIYINKTIAEHVMNCILRFGVKPPPVKKERVIVDFSSPNIAKEMHVGHLRSTIIG
DSISRILEYLGHDVLRLNHLGDWGTQFGMLIAHLQDKYPNFKTHSPPISDLQAFYKESKK
RFDEDEEFKKRAYACVVQLQSHQPDYIAAWKLICEVSRQEFQKIYDRLNINLIGRGESFY
QDRMDAVVKQLKDGGYLEEDEGRLIMWGDPVKKDGIPLTVVKSDGGYTYDTSDMAAIKQR
VEEEKGNRFIYVVDAGQSTHFVTIDACARRAGILKNSQKIEFVGFGVVLGEDKKKFKTRS
GDTIKLLDLLEEGLKRSLDKLIEKGRDKVLSPEELKLAQEAVAYGCIKYADLSHNRVNDY
VFSFDKMLDDKGNTAVYLLYALTRIRSIARTAQISFDQLLAEVDKTGFKFGHEAEWKLGK
VLLRFPEIILKVSNDLYLHSLCEYLYEISSAFTEFYDKCYCVEKDKEGKIVNIIYTRLML
CEATARVMEKSLDILGIKTVSKM
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcaggagcagaagaatttggaggaacgtacaattcgagccgaaaaggatgca
aaggccattgaggaggagttggacaaaatatccaaaggcgacctcagttacattggcgac
cctcggctagaaaaactatattctgagaatgagaagctcaaacaccgcttagttatctta
gaaaatgcgattaaagccgaaagttcggggtctcagaagccagctgtcagtaaagagaag
aaacttcccaccctaataacagacatcaactctgtggaaggcaacatatgcatcgtagat
gaacttaaaaacatatttgaattcgctattggatctgcctatccagatttagaggatcca
ccaattgtaattacattgtcaggtaacaatcctaaattcggagactatcaatgtaattca
gcaatgcctatctcacaattactcaaggctaagaatattaaatctaatccgcgggaagtg
gctaacaacatcttaaacaaaacaccatcatcaccatttattgagagaatagaagtagcg
ggagcaggtttcttgaatatatacatcaacaaaacgattgctgaacatgttatgaattgt
atcctacggtttggagttaaaccgccccctgtgaagaaagagagggttatagttgatttc
tcatctcccaacatagctaaggagatgcacgttggtcatttgagatccactataattgga
gacagcatttctcgcatactagagtacttgggccatgatgtccttaggctgaatcactta
ggagactggggtactcagtttggaatgttgattgctcacttacaagacaaatatcccaac
ttcaaaacccactcacccccaatctcagatctacaagcattctataaagaatctaagaaa
aggtttgatgaagatgaagagttcaagaagagggcatacgcttgtgttgtccagctgcag
tcccatcaaccagattacatagccgcatggaaactgatatgtgaagtgtctcgccaggaa
ttccagaagatttatgaccgacttaacatcaatctaattggtcgaggggaatctttctac
caagacagaatggacgctgttgtcaaacagctcaaggatggtggctacttggaggaagat
gaagggcgactcattatgtggggggatcctgtgaagaaagatggcataccactaacagta
gtcaagtctgatggtggctacacatatgacacatctgacatggcagccataaagcagagg
gtggaagaagaaaagggcaacaggtttatctatgttgtagatgctggacagtccacacat
tttgtcaccatagatgcatgtgctcgaagggctggcatacttaaaaactcacagaagata
gaatttgttggctttggtgttgttctaggagaagataaaaagaagttcaaaactaggtct
ggtgacacaattaaactattagacttgcttgaggaaggtctcaagaggtcgctagacaaa
ttgatcgaaaaaggacgagacaaagtcctgtcgcctgaagaactgaaacttgcacaagaa
gcagttgcttatgggtgcatcaagtacgctgatctctcacacaacagggtaaacgattat
gtgttctcttttgataagatgttggatgacaagggtaacacagctgtgtacctgttgtat
gctctgacacggatcaggtcaatcgcaaggacggcgcagatctcgttcgaccagcttttg
gctgaggttgataagactggctttaagtttggccatgaagctgaatggaaactgggcaaa
gtcttacttcgattcccagaaattatactgaaagtatcaaatgatctctaccttcacagc
ttatgtgaatatttatatgaaatatcttcagcattcacagagttctatgataaatgctac
tgtgtcgagaaggacaaggaaggtaagatcgtcaacatcatctacaccaggctgatgctg
tgtgaagccactgccagggttatggagaagagcttagacattcttggaatcaaaactgtc
tctaaaatgtaa

DBGET integrated database retrieval system