KEGG   Trichoplusia ni (cabbage looper): 113498002Help
Entry
113498002         CDS       T05757                                 

Definition
(RefSeq) sphingosine kinase 1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
tnl  Trichoplusia ni (cabbage looper)
Pathway
tnl00600  Sphingolipid metabolism
tnl01100  Metabolic pathways
Module
tnl_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:tnl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    113498002
Enzymes [BR:tnl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     113498002
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 113498002
NCBI-ProteinID: XP_026733666
Position
10
AA seq 607 aa AA seqDB search
MADQKNGKDVPNVGEGDSVSKDVVYLEETFYILSKKNSVFRVQLTSKGLTLTKETDGNSK
EQTILLRDIIGSKCMRSKRRRPGAGSCVCSSFVGNNQLKVVDENSGDLDENDISAYLYIY
AYILKRSRRTLKRERTTITLRFRSFDKYEDNNREAQKWRTTIKCLIASLPITYSPPTNDK
KVLVLLNPKSGPGKARELFQSKVVPILQEAEVPYDLHVTKYAQYAREFVRTRNVYGWRAI
LAIGGDGVLFEIMNGMFERLDWQQALAEVPLAILPCGSGNGLARTICHLYNEPYIPQNLT
GLSMAIVKGQTAPMDVVRIETRTKIMFSFLSVGWGLLSDIDIESERLRAIGGQRFAVWAV
ARLVGLRTYKGVVSYAKIKDVSNLPKPKQPLTLSHSISQDGALDSPDAEAFIDCDEHSEV
FVNAVNGKQHQRVDSWYSVNSRRSAFYSTRGSEYHSVTSEGSEMRSPVHACMHGPASHLP
SLMSQLPSQWVHEEGEFVMVHVSYQPYIGEDFLFAPRSQLSDGVMWMLIIKAGIPRSQIL
SFLLGVGQGSHADLNTEHIKMVPVSAFRIVPEGTTGYITVDGEVVEYGPIQAEIFPNIVN
LLVPETK
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atggcggatcaaaagaacgggaaggacgtaccaaacgtcggggagggtgactctgtttcg
aaagatgttgtttatcttgaagaaacattttacattctttctaagaagaattccgtattt
cgtgttcagctcacgtccaaaggtttaactttaacaaaggaaactgacggcaactcaaag
gaacaaacaatattgttgcgggatatcattggtagtaaatgcatgaggagtaagagacga
cgccctggagccggctcttgcgtctgcagctccttcgttggtaacaaccagctcaaagta
gtggacgagaacagtggcgatctcgacgaaaatgatatcagtgcatacttatatatttat
gcttacatactgaaacgtagtcgccgcactcttaaaagagagagaacaacaataacattg
cgattcaggtctttcgataaatacgaagataataacagagaagcccaaaaatggagaacc
accataaagtgtttgatagcaagtctgccgattacgtattcgccgccgactaatgataag
aaagtacttgtccttctaaacccgaaatcaggtccgggcaaagcgagagagttgttccag
tcaaaagtggtgccgatactgcaagaggcggaggtaccttacgacctccatgttactaaa
tatgctcagtatgcacgtgagtttgtgcgcacgcgaaatgtgtacggttggcgcgcaatt
ttagcaatcggcggcgatggcgtgttgtttgaaatcatgaatggcatgttcgagcgactg
gactggcaacaggcattggcagaagttcctcttgccattttgccatgtggatctggcaat
ggcctggcaagaactatctgtcatttgtataatgagccgtacattccgcaaaaccttaca
ggactttcgatggctatagttaagggtcaaacagcgcccatggatgtcgtccgaattgaa
acgagaaccaaaattatgttttcgttcctatccgtgggctggggcctgctatcggatata
gatatagaaagtgaaagattacgcgctatcggtggacagaggttcgcagtgtgggcagtc
gcgagactcgtcggactgaggacatataaaggtgtagtcagttacgcgaaaataaaggat
gtgagtaatctgcctaaaccaaaacaaccgctcaccctcagtcacagcatcagtcaggac
ggcgcgctcgactcccctgatgcggaagcgttcattgactgcgacgaacattccgaagtg
ttcgtaaacgctgttaatggaaaacaacatcagagggttgattcgtggtactctgtgaac
tcgcgcaggagtgcgttctacagcacgcgcgggtcagagtaccacagcgtgacgagtgaa
ggctcggaaatgcggtcgcccgttcacgcgtgcatgcacggacctgcttcacaccttccc
tcgctcatgtcccagttgccttcgcaatgggtgcacgaggaaggcgaattcgttatggtc
cacgtctcataccaaccctacatcggcgaagactttctgttcgcgccgcgatcccagcta
tccgacggtgtcatgtggatgttgatcataaaagcaggcatacccagatctcagatactt
tcgttcctattgggtgtgggccaaggttcccatgctgatttgaacactgaacatattaaa
atggtaccagtgagtgcgtttagaatagtaccagaaggcaccacgggttatatcacggtc
gacggcgaagtcgtcgagtatggacccatacaggctgaaatattccccaatatagtaaat
ttattagtgccggaaacgaaataa

DBGET integrated database retrieval system