KEGG   Trichoplusia ni (cabbage looper): 113498486Help
Entry
113498486         CDS       T05757                                 

Definition
(RefSeq) MAP kinase-activated protein kinase 2 isoform X1
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
tnl  Trichoplusia ni (cabbage looper)
Brite
KEGG Orthology (KO) [BR:tnl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tnl01001]
    113498486
Enzymes [BR:tnl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113498486
Protein kinases [BR:tnl01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   113498486
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 113498486
NCBI-ProteinID: XP_026734296
Position
11
AA seq 349 aa AA seqDB search
MSNFTKFIKTTPITDDYEISNTVLGLGINGKVVECKEKTTGAKRALKVLHDNTKARREVE
LHWRARGCIHIVQVIDVYENSYGGRGCLLVVMECMDGGELFQRIQDNREGAFTERQAAEI
MHSICVAVRHLHDSNIAHRDIKPENLLYSSTQPNAVLKLTDFGFAKETLTPADTLQTPCY
TPYYVAPEVLGPEKYDKSCDIWSLGVVMYILLCGFPPFYSNHGLAISPGMKKRIRLGQYD
FPEPEWSNVSTEAKNLIKGMLSVDPAKRLTIQQVMSSPWVRAYTQVPQTPLYTHTLLREG
GDAWADVQDEMTRSLATMRVDYDQVTVQIKTLEQSNNSLLNKRRNKVGA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagtaattttacgaaatttatcaaaactacgccaatcactgacgactacgaaatctcc
aacacggtcctcggcctcggaatcaacggaaaggtcgtagaatgcaaagagaagacgacc
ggtgctaagcgtgcattgaaagtcttgcatgacaatacaaaggcacgccgggaggttgag
ctgcattggagagcgcgcggctgtattcacatcgttcaggtgatagacgtgtacgagaac
tcctacggtggccgaggatgtctcctggtcgtcatggagtgcatggacggaggcgagctg
ttccagaggatccaggataatagggaaggagcttttactgaacgacaggctgctgagata
atgcactcaatatgtgtagctgtccgtcacctccacgattcgaacatcgcccaccgggac
atcaaacccgagaacctgctgtactccagcactcagcccaacgccgtcctcaaactgacc
gatttcggcttcgctaaggagaccttgacgccagctgatacgttgcagactccttgctat
acaccttattatgtggctcccgaggtgcttggaccagaaaaatatgacaaatcttgtgac
atctggtctttaggagttgtgatgtacatcctgctgtgtggattcccgcctttctactcc
aaccatggactggctatatcaccagggatgaaaaagcgcatcagactaggccaatacgac
tttccggagcccgagtggtcgaacgtatccaccgaagctaagaatctcattaagggcatg
ctgtccgtcgaccccgccaaaagattgactattcaacaggtgatgtcgagcccgtgggtc
cgcgcgtacacgcaggtcccgcagacgccgctgtacacgcacacgctgctgcgcgagggc
ggcgacgcctgggccgacgtgcaggacgagatgacgcgctcgctcgccaccatgcgcgtc
gactacgatcaggtgacggttcaaattaaaacgctagaacagagcaacaattcgctttta
aacaaacggagaaacaaagtcggggcttga

DBGET integrated database retrieval system