KEGG   Trichoplusia ni (cabbage looper): 113499517Help
Entry
113499517         CDS       T05757                                 

Definition
(RefSeq) aminomethyltransferase, mitochondrial
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
tnl  Trichoplusia ni (cabbage looper)
Pathway
tnl00260  Glycine, serine and threonine metabolism
tnl00630  Glyoxylate and dicarboxylate metabolism
tnl00670  One carbon pool by folate
tnl01100  Metabolic pathways
tnl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tnl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    113499517
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    113499517
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    113499517
Enzymes [BR:tnl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     113499517
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-GeneID: 113499517
NCBI-ProteinID: XP_026735827
Position
12
AA seq 410 aa AA seqDB search
MCSISRTKALIVPRFLTPKQIVPATLRWYSDESKATKTPLYNLHNKYGGKVVDFAGFLLP
VQYSDLSLSESHLFTRKSASIFDVSHMLQTNVRGKDCLSWFETLCPVDLKGMKNGSSSLT
VFLNEKGGIIDDLIVTKVNDENLYVVSNAGRLAVDKQHMKETSELFRKKGKDVHVQFFNT
SERALIALQGPKAASVLQNVTDIPINDLMFMTSTLGKVAGVVCRVTRCGYTGEDGVEISI
PAERAEEVTEALLQFDDVKLAGLGARDSLRLEAGLCLYGNDIDESVSPVEANLTWLIAKR
RRAEDNFPGSSIILRQIKEGVTKRRVGIRMETGPPARKGAVLKDSKTSETVGAITSGCPA
PSLGGNVAMGYVSETLKKSGTELLVNIRGKDVPCVVAKMPFVPAKYYVKK
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtgttctatatcacgtacgaaagctttgatcgttccaagatttctaactcctaagcaa
atagtgccggcaacgttacgatggtacagtgatgaatctaaagcaacgaagacaccttta
tacaatttgcacaacaaatatggaggtaaagtggtcgatttcgcaggtttcctgttacca
gtgcaatactctgatttaagtctatcagaatctcacttgtttacaagaaaaagtgcctct
atattcgacgtctctcatatgttacaaacaaacgtacgtggcaaggattgtctctcttgg
tttgagacattgtgcccggtagatttaaaagggatgaaaaatggaagtagctccctcaca
gtattcttgaatgaaaagggaggaataatagacgacttgattgtaactaaagtaaatgat
gaaaatttatatgtagtttcaaacgctggtcggcttgcggtagataagcagcacatgaaa
gaaacgtcagaactatttaggaaaaagggcaaggacgttcacgttcaattctttaatact
agtgagagagctcttattgcccttcagggtcctaaagcagcttcagttctccaaaatgtt
accgatattccgatcaatgacctaatgttcatgacatctactctgggaaaagtagcaggc
gttgtttgtcgagttacacgttgcggatacaccggtgaagatggtgttgaaatatcgata
ccagcggaaagggccgaagaagtaacagaagcgttactacagtttgacgatgtgaaactt
gcaggactcggtgctcgagactctttgcggttagaagccggtttgtgcctttacggcaac
gacatcgatgaaagtgtgtcgcctgtagaagctaatttaacttggctgatagctaagcga
aggcgggcagaagacaatttcccgggatcttccattatcttgcgtcaaataaaagaaggt
gtaacgaaacggcgagtgggtattcgcatggaaacgggccctccggcaagaaagggcgct
gtcttgaaagactcgaaaacttctgaaactgtgggtgctattactagcggttgcccagcg
ccatcgctaggtggaaatgttgctatgggctacgtatcagagacgctgaagaagtctgga
acggaactattagtgaacattagaggaaaggacgttccttgtgttgttgctaaaatgccg
ttcgtacctgcgaaatattacgtcaaaaaataa

DBGET integrated database retrieval system