KEGG   Trichoplusia ni (cabbage looper): 113501546Help
Entry
113501546         CDS       T05757                                 

Definition
(RefSeq) dedicator of cytokinesis protein 7 isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
tnl  Trichoplusia ni (cabbage looper)
Brite
KEGG Orthology (KO) [BR:tnl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tnl04131]
    113501546
Membrane trafficking [BR:tnl04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    113501546
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N GDI Geminin
Motif
Other DBs
NCBI-GeneID: 113501546
NCBI-ProteinID: XP_026738533
Position
15
AA seq 1963 aa AA seqDB search
MTLGRKYQQSSGNAGEARKVYSNQSKVGTLSGCSSSLSLCDMIEPPDYEEVCDRLMGERD
PLAYPAVDMELCNVPRRIRTLTHVLPDEDLAKAPMFVRDCIRTYTTDYTVVEYKHRQHSG
SMCGRERLAERLERLHAAPRHQYEVDAELSTSTEELAPQQSESQPSSGRQSVASMSSSSS
CNETLTPRGSWASLDLRSSSSDPLLPDLFERKPPDQMDAVNEARRLENRQADLLGLYTPY
LDEEEAVERRLAAEMPCEVMGHRILVVCHQLKLELDVEPLFASMALYDAKEKKKVSENFY
FNLNSEATRQMLAPHVPHADLSTFSRSAVFDILNPSPDLFLVVRVEKVLQGDVNECVEPY
IKDDKNREKVRAGALAACARLGKYRMPLAWSAVALLNVLSGTNSLEREHDAPAQHNTNSL
DRKASSSSLEQLRRRAGEVGGSLSRKGSVERRAPPPPRDDLPHQLDTFKPIVITVTSFFK
QETDKLRDEDLYKFLAEIKRPSSAPKKLKCIPGTLKIEVSPCPDEIKNGLTPELAKLHPY
GDDNVRPCKEILPFPSVSPAVPHYQYRNLLYVSVRELNLNAYTSRTGSARNITVRIQLMS
GENQEAALPAIFGRSSCPEFTNEAYTTVLYHNKNPSLYDEIKLKLPADLGDQHHLFFTFL
HVSCQRKPVAPDQEKNLETPVGYSWLPLCRNGKLTCGEFSLGVMQEEPPANYSYIFPDVQ
LPGTRWIDNHKPIFSIVLDAHTTVHPLDGYIERFAMACEAVQEGNIPPRIGLANMEAELR
ASISELPTASVETVSRYLPVLLDKLLRLLLAPPALAGHTLNIAQDVFTCLAHLFTDISNM
NEGSTCDNHGRSSLISTYIQYQCTIPRPSLTDRDIGLPLPPAVMTDGSCKILHEELALQW
VVASGATRDLAMQNSWALFELMVKSMVEYLYWSGAAEARRKARFPDQFTDDLTTLVNNVT
TEIISRYGKDSRLTQSLNNSLAFFLFELLSIMDRGYVFNLIRTYYKQMCAKIASLPDAVP
LVHYKLAFLRIICSHEHYVSLNLPLAAGGAAGGVSPAASWQSLGSQSSAPPRHALGHEFR
SRHYLAGLLLTELTNALELQSPVLQMAAVNGVLSLLTAHDADPRLAAEERARVAALYLPL
LGIVMDAQPQLYRGFATNKEILQLDSDMGQFNNLYTASSPEGEFKQNGRPPFNSETSRNL
LMCLVWVLKWAERGALTACVAELAPARLHALLALIDLCFKCQEYKGRKEIMKCAHQNVRK
TTDIKAKLEDVILGQGSARNDFIMRRKGGGSSVGACRRERWRKDWARGGARGGAEQPPAP
SPHLAAALAAEVALTLLHALDTIVQSCSNLECGQSVCSAALQVVLRALQRNQSVVVLQHM
FATVRALIVKLGWSCCGEESGICRVLLRHCAALSAPTRSHASATLYALMRQHYQLGNNFS
RVKMQVTMSLSSLVGTSTTFSEESLRRALKTILMYAEHDTDLADTTFPEQVKDLVFNLHM
ILSDTVKMKEFQEDPEMLLDLMHRIARGYQHSPDLRLTWLNNMAQKHMERSNHTEAGMCL
VHGAALVAEQTGAGGRGAALLQRVTHNALDESCADALHHHLTHQELQALLEHAASELMTA
GMYETVNEVYKVLIPIAEEHRDYKKLANIHSKLNEAFTRIEQLHGKRVFGTYFRVSFYGA
RFGDLDGEEFIYKEHALTKLPEIFSRLENFYGARFGVDNVVIIKDSNIVDLSTLDADKAY
IQITYVEPYFEPHELRKRVTQYEKNYNIKRFMYATPFTLGGRAHGDIAEQCKRKTILTAA
HHFPYVKTRIQVVQRTQIILSPIEVAIEDIQKKINELAAATSQEPADPKMLQMVVQGCIG
TTVNQGPLELAQVFLAPVAEGTQPPTRLTNKLRLAFKDFSKKCHDALKKNKNLIGSDQRE
YQRELERNFQRFTERLAPLIQATPGHVAQLSNGLSKHDYKYQA
NT seq 5892 nt NT seq  +upstreamnt  +downstreamnt
atgactcttggacgtaaataccagcaatcttccgggaatgctggggaggctcgtaaggtg
tattctaaccagtcgaaggtcgggactctatcgggttgctcgtcttctctatcactgtgc
gacatgattgagccaccggactacgaggaggtgtgtgaccggctgatgggcgagcgggac
cctctcgcttaccctgccgtggacatggaactgtgtaacgtgccgcgtcgcatcaggacc
ctgacacacgtgctgcctgatgaggatcttgcaaaagctccgatgttcgtgcgcgactgt
atccgcacttacactacggactatacggtagttgagtacaagcaccggcagcactcgggc
agtatgtgcgggcgcgagcggctggccgagcggctggagcggctgcacgcggcgccgcga
caccagtacgaggtggacgccgagctgtccacctccaccgaggagctggcgccgcaacag
tcggaatctcagccatcaagcggtcgtcagtcagtagcgtccatgtcgtcctcatcatct
tgcaacgagaccctcactcctcgcggctcctgggcgagcctggacctccggagctcgtcc
tccgaccctctgctgccagacctcttcgaaaggaagccgcctgatcagatggatgctgtt
aatgaagctagaagactggaaaaccgtcaagctgatctcctgggcctgtacactccgtac
ctggacgaggaggaggcggtggagcggcggctggcggccgaaatgccctgcgaggtcatg
gggcacaggatcctcgtcgtctgccaccagctcaagctagaactcgacgtggaaccgctc
ttcgcctccatggcattatacgacgctaaagagaagaagaaagtgtcagagaacttctac
ttcaacctaaactctgaagcgacacgacagatgctggccccgcacgtgcctcacgctgac
ctgtccacgttcagccggagtgccgtgttcgatatactgaacccatcacctgatctgttc
ctggtggtcagggttgagaaggtcttacagggagatgtgaacgagtgtgtcgaaccgtat
atcaaggatgataagaaccgcgagaaggtccgcgcgggcgcgctggcggcgtgcgctcgc
ctgggcaagtaccgcatgccgctggcctggagcgccgtggccctgctcaacgtgctcagc
gggaccaacagcctcgagcgcgagcacgacgcgcccgcgcaacacaacaccaacagtctg
gaccgcaaggcgtcgtccagcagcctggagcagctgcggcggcgcgcgggcgaggtgggc
ggctcgctgtcgcgcaagggcagcgtggagcggcgcgcgccgccgccgccgcgggacgac
ctgccgcaccagctcgacaccttcaagcccatcgtcatcactgtcactagcttctttaaa
caggaaacagacaaactccgtgatgaagacttatacaagttcctagcagagatcaagagg
cctagttcagctcctaagaagctgaaatgtatccccggtactctgaagatagaagtatcg
ccgtgtccggacgaaatcaagaacggactgacacccgagctggccaaattacatccttat
ggagatgacaacgtgcgtccgtgcaaggagatcttaccgttcccgagcgtgtcgccggcc
gtccctcactaccagtaccggaacctgctgtacgtgtccgtgcgggaactcaacctcaac
gcctacacctcaaggacaggctccgccaggaacataaccgtccgaatacagctgatgtct
ggtgagaaccaggaggcggcgttgccagctatcttcgggcgcagttcctgccccgagttc
acgaacgaggcttacactactgtactgtaccacaataagaacccctctctctacgacgag
ataaagctgaagctaccagcagacctgggcgaccagcaccacctgttcttcacgttcctg
cacgtgtcctgccagaggaagcccgtcgcgcccgaccaggagaagaacctcgagacgcct
gttggatactcgtggctcccgctgtgccgcaacggcaagctgacgtgcggcgagttcagc
ctgggcgtgatgcaggaggagccgcccgccaactactcgtacatcttccccgacgtgcag
ctgcccggcacgcgctggatcgacaaccacaagcccatcttcagcatcgtgctggacgcc
cacaccactgtgcacccgctggacggttacatagagcggttcgcgatggcgtgtgaggct
gtgcaagaaggcaacatcccgccgcggatcgggctcgccaacatggaggccgagttacgg
gctagcatctcggagctgccgacggccagcgtggagacggtgtcccgctacctgcccgtg
ctgctggacaagctgctgcggctgctgctggcgccgcccgcgctggccggacacacgctc
aacatcgcgcaggacgtcttcacctgcctcgcacatctcttcactgacatctccaacatg
aacgaaggctcgacgtgcgacaaccacggtcgcagcagcctcatcagcacgtacatccag
taccagtgcaccatcccgcgaccctcgctcaccgacagggacatcggcctgccgctgccg
cctgccgtgatgacggacgggtcgtgtaagatcctgcacgaggagctggcgctgcagtgg
gtggtggccagcggcgccaccagggacctcgccatgcagaactcctgggctctgttcgag
ctgatggtgaagtcgatggtggagtacctgtactggtccggcgcggccgaggcccggcgc
aaggcgcgcttccccgaccagttcactgatgacctcaccacgcttgtcaataacgtcact
acagagatcatctccagatacggcaaagatagccgcttaacccagagcctgaacaacagc
ctggcgttcttcctgttcgagctgctgagcattatggaccgcggctacgtgttcaacctc
atccgcacctactacaagcagatgtgcgctaagatcgcgtcgttacctgatgctgtaccg
ctcgttcattataagctggcgttcctccgcatcatctgctcgcacgagcactacgtgtcg
ctgaacctgccgctggcggcgggcggcgcggcgggcggcgtgtcccccgccgcctcgtgg
cagtcgctgggctcgcagtccagcgcgccgccccgacacgcgctcggacacgagttccgc
tcccgccactacctggccggcctgctgctcactgagctcactaacgccttggaactgcaa
agcccggtcctgcagatggcggcggtgaacggcgtcctgtcgctgctgacggcgcacgac
gcggacccgcgcctggcggccgaggagcgggcgcgcgtggcggcgctgtacctgccgctg
ctgggcatcgtcatggacgcgcagccgcagctctacagggggtttgccaccaacaaggaa
atacttcaacttgacagtgacatgggacagttcaataatctatacaccgcgtcatcacca
gaaggtgaattcaagcagaacggtcgtcctccgttcaacagcgagacgagccgcaacctg
ctgatgtgcctggtgtgggtgctgaagtgggcggagcggggcgcgctcacggcctgcgtg
gccgagctggccccggcccgtctgcacgccctgctggcgctcatcgacctgtgcttcaag
tgccaggagtacaagggacgcaaggagataatgaaatgcgcgcatcaaaacgtgcgcaag
acaaccgacattaaggctaagttagaagatgtgatcctcggacagggctccgcgcgcaac
gacttcatcatgaggcggaaaggtggtggttcgagcgtaggtgcgtgccggcgggagagg
tggcgcaaggactgggcgcggggcggcgcgcggggcggggccgagcagccgcccgccccc
agcccgcacctggccgccgccctcgcggctgaggtggcgctcacgctgctgcacgcgcta
gataccatcgtgcagtcatgtagcaacttagaatgcgggcaaagtgtgtgtagcgcggcg
ttacaagtcgtgttgcgagctctgcagcgcaaccagagcgtcgttgtgttgcaacacatg
ttcgcgactgtgcgcgctctcatcgtcaagctgggctggtcgtgctgcggcgaggagtcg
ggcatctgccgcgtgctgctgcggcactgcgccgcgctgtccgcgcccacgcgctcgcac
gcctccgccacgctgtacgcgctcatgcgccaacactaccagctcgggaacaacttcagc
cgcgtgaagatgcaagtgaccatgtcgctatcctcgctggtgggcacgtccacgaccttc
agcgaggagtcgctgcggcgcgcgctcaagaccatcctcatgtacgccgagcacgacacc
gacctcgccgacaccaccttccctgaacaggtcaaagatctggttttcaacctgcacatg
atcctgtcggacacggtgaagatgaaggagttccaggaggaccccgagatgctgctggac
ctgatgcaccgcattgcgcgagggtaccagcacagccccgatctgaggctgacgtggctg
aataatatggcgcagaagcatatggagcgttcgaaccacacggaggcgggcatgtgcctg
gtgcatggcgcggcgctggtggcggagcagacgggcgcgggcgggcgcggcgccgccctg
ctgcagcgggtcacacacaacgcgctcgacgagagctgcgccgacgcgctgcaccaccac
ctcacgcaccaggagctgcaggccctgctggagcacgcggccagcgagctgatgacggcc
ggcatgtacgagacggtgaacgaggtgtacaaggtgctcatacccatcgccgaggaacac
cgggactacaagaaactcgccaacatacacagcaagctgaacgaagccttcacccgcatc
gagcagctgcacggcaagcgcgtgttcggcacgtacttccgcgtgtcgttctacggcgcg
cgcttcggggacctcgacggcgaggagttcatctacaaggagcacgcgctcaccaagctg
cccgagatcttcagcaggctcgagaacttctacggcgcccgtttcggcgtggacaacgtg
gtgatcataaaggactcgaacatcgtggacctgagcacgctggacgcggacaaggcctac
atacagatcacgtacgtggagccctacttcgagccgcacgagctgcgcaagcgcgtcacg
cagtacgagaagaactataacatcaagcgcttcatgtacgcgaccccgttcacgctgggc
gggcgcgctcacggcgacatcgccgagcagtgcaagaggaagaccatcctcaccgccgca
caccacttcccctacgtcaagacacggatacaggtggtacagcgaacgcaaattatttta
tcgcccattgaagtagccatagaagatatacagaaaaagatcaacgagctagcggcggcg
acgagccaggagccggccgaccccaagatgctgcagatggtggtccagggctgcatcggg
accaccgtcaaccaggggccgctcgaactggcgcaggtgttccttgctccggtagctgaa
ggcactcagcctccgacacggctcacaaacaaactgcgactcgccttcaaagacttctct
aagaaatgccacgacgcgctgaagaagaacaagaacctgatcggcagcgaccagcgcgag
taccagcgcgagctcgagcggaacttccagaggttcaccgagagactggcgccgctcata
caggccacgcccgggcatgtcgcgcaactcagcaatgggctgagcaagcacgactacaag
tatcaagcttaa

DBGET integrated database retrieval system