KEGG   Trichoplusia ni (cabbage looper): 113501996Help
Entry
113501996         CDS       T05757                                 

Definition
(RefSeq) tripeptidyl-peptidase 2
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
tnl  Trichoplusia ni (cabbage looper)
Brite
KEGG Orthology (KO) [BR:tnl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tnl01002]
    113501996
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:tnl03110]
    113501996
Enzymes [BR:tnl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     113501996
Peptidases and inhibitors [BR:tnl01002]
 Serine peptidases
  Family S8: subtilisin family
   113501996
Chaperones and folding catalysts [BR:tnl03110]
 Intramolecular chaperones
  Subtilisin family
   113501996
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPPII Peptidase_S8 TPPII_N AP_endonuc_2
Motif
Other DBs
NCBI-GeneID: 113501996
NCBI-ProteinID: XP_026739146
Position
16
AA seq 1334 aa AA seqDB search
MKALGRISYHILAKYKNKYSGKNLVIRMTVNCVLPDLESKTCYNNMCYRSFNEDKHNEAG
KVIRSSKMADSPIDCDFPVWGLLPKKETGVVSFINKNPNYDGRDTVIAIFDSGVDPAAEG
LKVTSTGETKVIERFDCSGCGDVDTSTVIRKVTDGCITGLTGRKLKIPEGWKNPTGSWRV
GVLYPFSLYPSKLKERIQEHRKEHEWDVGYKPAFAEANKQLQDFETDVASKTPTLSPEDK
ILKEELEARVEVLQAAEKKYNDVGPTYDCVLFHDGSIWRACIDTSECGDLASGPFLGEYS
VTHEHTHLTPFDEMTISINVHDEGHTLEVVGMCSTHGTHVAAIAAGYFPSEPDRNGVAPG
AKLVSLTIGDSRLGSMETGTALVRACIKVMELSKRMRIDVINMSYGEHAHWSNAGRIGDI
ICEVVNRYNVSWVVSAGNHGPALCTVGAPPDIAQPILIGVGAYVSPEMMSAAYSMRARVC
GGAFSWSSRGPAADGAPGLAVCAPGGAVAAVARFTLRNCQLMNGTSMAAPHVAGAVAALI
SGLKAKNLPYSPYSIKRALENSATYLSHVEPWAQGCGLLNVEKAFELLSTHWSAAERDVT
FSVSCGPGAAKGVLLRPRPGDPPRDLGLSVEPRFLQDHTDMQNKSIIPKQIAFGVRLALG
CDAAWLSAPQHLDMMNAARPFTIRVDTTSLPPGPHFTSINAYDVSCVEKGPVFRIPVTVL
QPQPLQLAAPAPPAIVEKKVLFKPATIVRHFVIVPPEATWGVLKISTDDKEKAGRFLVHT
MQLLPKRSCRCHETQKMINVNAEAPTVLPFQLVGGVTLEVVIAKYWANIGDISVDYSVEF
HGLKPDFGSRLTLGAGEAVRPVLLAALRLQDVQPSATLKYSEPVVRPTETKLSPLTARDV
IPPSRQIYQLVNIYNFHIAKATEVSPIISLLCDMLYESEFESQMWMLYNSCKQLMAVGDA
YPSKYSVKLEKGDYILRLNIRHENKALLEKLQELPATIQQRLQQPITLDVYCSQPMAITG
GKKFSSCSLSNGQLLPLYFTSVPSDKVSRSLGAAGQALAGGVTFAKDELGRKVDTYGLHV
LLPEPPKRAPAPKDKARPNDDYMDALKDFCTGWLAKLEGDKLEQVYEELVEKFPGYLGAH
IAYLHALDPPTDAKKLPHANEDPDVTTAWCEQLITIADKVIKAIDQEKLLAYLGMKNDTR
SDANKIKQEQDKARWQAVEALSRRGAALCRLRALAHSGAARDKLTDALHNNMADLLKFAD
LTDAKAIHYGVWHCFSFKQWGRAVKLLLKIQEERPSKEVEERLIEAYQQLGWNFYAKAAQ
SALPIKYPSTYRPF
NT seq 4005 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactgggcagaatttcgtaccacatcttagcaaaatataagaacaaatatagt
ggaaagaacttggtgatacgaatgacagttaactgtgtgttgccagatcttgaatcaaaa
acttgttacaataacatgtgctaccgaagttttaatgaagataaacacaacgaagcaggt
aaagttatcaggtcatcaaaaatggcagactctccgatcgactgtgacttccctgtttgg
ggactattaccgaaaaaagagacgggggttgtatcctttatcaataaaaatcccaactat
gatggaagggatactgttattgcaatatttgactcgggcgtggacccagcagccgaagga
ttaaaggtgacaagtacaggagaaacgaaggtgatcgaaaggtttgactgcagcggctgt
ggcgatgtggatactagtactgtcattagaaaagttaccgatggatgcattaccggtctt
acgggtcgcaaactgaagatcccagagggatggaagaatccaactggctcatggcgtgtg
ggtgtgctataccctttcagtttgtacccttctaagttgaaggaacgcatacaagagcac
cgcaaagaacatgagtgggatgtagggtacaagccagcatttgctgaagccaacaagcaa
ttgcaagactttgaaactgatgttgcatcaaaaactccaacattaagtcctgaagataag
atcctaaaggaggagctggaagccagagtggaagtgctgcaggcagctgaaaagaagtac
aatgatgtgggacccacttatgactgtgtgctgttccatgatggcagtatttggagagca
tgtatcgacacgtcggagtgcggcgacctggcgtccgggccgttcctgggcgagtacagc
gtcacacacgagcacacgcacctcacgcccttcgacgagatgaccatcagcatcaacgtg
cacgatgagggacacacgctcgaggtcgtcggcatgtgctcgactcacggcacgcacgtg
gcggccatcgcggcgggctacttcccgtcggagccggaccgcaacggcgtggcgccgggc
gccaagctggtgtcgctcaccatcggggacagccgcctcggctccatggagaccggcacg
gcgctcgtgcgcgcctgcatcaaggtcatggagctctccaagcgcatgcgcatcgacgtc
atcaacatgagctacggcgagcacgcgcactggtccaacgcggggcgtatcggtgatata
atctgtgaggttgtgaaccgctacaatgtctcatgggtggtgtcggctggaaaccacgga
ccagccctgtgcactgtaggagctccgcctgacatagcgcagcctatattaattggtgtg
ggcgcgtacgtgtccccggagatgatgtcggcggcgtactccatgcgcgcgcgcgtgtgc
ggcggcgccttcagctggagctcgcgcgggcccgcggccgacggcgcgcctggcctggcc
gtctgcgcgcccggcggggccgtcgccgccgtcgccagattcactttgcgaaactgtcaa
cttatgaacggcacgtccatggcagcgcctcatgtagccggagcagtagcggcccttatc
tcgggtctgaaggcgaagaatctcccttactcgccgtactcgatcaagcgcgccctggag
aactctgccacgtacttgtctcacgttgagccttgggctcaaggctgtgggctgctcaat
gtggagaaggcgttcgagctgctgtcgacgcactggtcggcggcggagcgcgacgtgacg
ttcagcgtgtcgtgcgggcccggcgccgccaagggcgtgctgctgcggccgcggcccggc
gacccgccgcgcgacctcggcctcagcgtcgagccgcgcttcctgcaggaccacaccgac
atgcagaacaagtcgataattccgaagcagatcgcgttcggcgtgcggctggcgctgggc
tgcgacgccgcctggctgtccgcgccgcaacacctcgacatgatgaacgcggccaggccc
ttcaccatcagggtcgacaccacctccctgccgcccggaccgcacttcactagtataaac
gcgtacgacgtgtcgtgcgtggagaagggcccggtgttccgcatcccggtgacggtcctg
cagccgcagccgctgcagctggccgcgcccgcgccgcccgccatcgtcgagaagaaggtg
ctcttcaagcccgccaccatcgtcaggcattttgttatcgtaccacctgaagccacgtgg
ggagtgttaaaaatctcaacggacgacaaggagaaggctggcagattcttagtgcatacc
atgcaattgttacctaaacgaagctgcaggtgtcacgagactcagaagatgatcaacgtg
aatgctgaagcacctacagtgctgccgttccagttagtaggcggtgtaactctggaggtg
gtgatagcaaagtattgggcgaacatcggcgacatatcggtggactacagcgtggagttc
cacgggctgaagccggactttggttcgcgactgacgctgggcgcgggcgaggccgtgcgg
cccgtgctgctggccgcgctgcgcctgcaggacgtgcagcccagcgccacgctcaagtac
tccgagcccgtcgtacggcctacagaaacaaaactttctccgctcacggcgcgtgatgtc
atccctcccagccggcaaatttatcaactagtcaatatttataacttccatattgccaag
gctacagaggtttcaccaataatatcgttgctttgcgacatgctatatgagtcggagttc
gaatcgcagatgtggatgttgtacaatagttgtaagcagctaatggcagttggagacgca
tatccttctaagtattctgtaaaactggagaaaggcgactacatactaagactaaacatt
cgtcatgagaataaagctttgctagaaaagttgcaagagttgccggccactattcagcaa
cggttgcagcaaccgatcacgctggacgtttactgctcgcaaccaatggcaataacggga
ggcaaaaaattcagttcgtgctccttgtcaaatggacaattattaccattgtacttcaca
tctgtaccctcagacaaggtgtcccgctcgctgggggcggcggggcaggcgctggcgggc
ggcgtgacgttcgccaaggacgagctgggccgcaaggtggacacgtacggcctgcacgtg
ctgctgcccgagccgcccaagcgcgcgcccgcgcccaaggacaaggcgcgccccaacgac
gactacatggacgcgctcaaggacttctgcaccggctggctcgccaagctcgagggtgat
aaactagaacaagtgtacgaagagttagttgaaaagttcccaggatacctcggcgctcat
atcgcgtacctgcacgcactagacccacctaccgatgctaagaaactacctcatgctaac
gaagatcctgatgtaacgacggcttggtgtgaacaacttattaccatagctgacaaggta
ataaaggctatcgatcaggagaaactgctcgcatacctcggtatgaagaatgatactcga
agtgatgcgaataaaataaagcaggagcaggacaaggcgcgctggcaggcggtggaggcg
ctgtcgcggcgcggcgcggcgctgtgccgcctgcgcgcgctggcgcacagcggcgcggcg
cgggacaagctcaccgacgcgctgcacaacaacatggccgacctgctcaagttcgcagac
ctcaccgacgccaaggcgatccactatggagtatggcactgcttcagcttcaaacaatgg
ggccgcgccgtgaagcttctgctcaagatccaagaggagcgcccctcaaaggaagtggaa
gagcggctcatagaagcctaccagcagctgggatggaacttctatgcgaaggcggcgcaa
tccgccctgcccatcaagtacccctcaacctacagaccgttctag

DBGET integrated database retrieval system