KEGG   Trichoplusia ni (cabbage looper): 113502432Help
Entry
113502432         CDS       T05757                                 

Definition
(RefSeq) nitrilase and fragile histidine triad fusion protein NitFhit isoform X1
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
tnl  Trichoplusia ni (cabbage looper)
Brite
KEGG Orthology (KO) [BR:tnl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    113502432
Enzymes [BR:tnl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     113502432
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase HIT DcpS_C
Motif
Other DBs
NCBI-GeneID: 113502432
NCBI-ProteinID: XP_026739797
Position
17
AA seq 511 aa AA seqDB search
MMRNWPMKLITTFSRLYSTRQASKTMTDGQRIAVCQMTSVEDKAKNLEVVASLIQDAAKE
DVQMLFFPEACDYLCANKKDAVCLAEPIIGGATIACYKQLAAQHNVWLSMGGVHEKDPSD
PSKAYNTHVIIDNKGEIVQTYRKLHLFDVEIPEKNLRLKESDIAHAGGHIVTPVETPVGR
VGLSICYDLRFPELSTALSILKAEILTYPSAFTQPTGKAHWHILLRARAIENQCYVIAAA
QSGTHNEKRRSYGHALCVDPWGTVLADCEEVSPCYKIVEISQQKLKEVRTNMPVFRHRRR
EVYSLYTLSLRKELLPAHNSNPPASASAPPPSSNEPGYTFGHVKVPETCVFYKSDLTYAF
VNLRCVIPGHVLVAPIRMAERNKDLTEEEAQDFYKSIRIVQALMEKVHSADSCTVTMQDG
RNAGQTVKHLHCHIMPRKKGDFIENDLIYLELAKHDQFKPGHPAKPARTREDMEAEAQYL
RTELEKMNNMTYIDGNRTAEKFGDTGSAAAV
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgatgcggaattggcccatgaaactcataacaacattttcacgattatattccacgaga
caagcatcaaagacaatgacggacggacaaagaatagctgtatgtcagatgacgtccgtc
gaggataaggcgaaaaatctagaggttgtagcaagcctgatacaggatgcagcaaaagaa
gatgttcagatgctattcttccccgaagcgtgcgactacttatgtgccaacaagaaagac
gcggtgtgtctcgccgagccaatcataggtggcgccactatagcctgttacaaacaactg
gccgcacagcataatgtatggctgtccatgggtggagtacatgaaaaggatccttcggac
ccctccaaagcatacaacacacatgtcataatagataataaaggggaaatagtccaaacg
tacagaaaactccatttatttgatgtagagattccagaaaagaatttgcggttgaaggaa
agtgacatagcacacgccggcggccatattgtcacgcccgtagagacacctgttggcaga
gttggtttatcaatctgctatgatcttcggtttcccgaactcagcactgctctcagtata
ttgaaggcagagatcttaacgtacccgtcagcgttcacgcaacccaccggcaaggcgcat
tggcatatattactcagagctcgcgccatagaaaaccaatgttacgtcatagctgcggcc
caatctgggacccacaatgagaaacgcaggtcctacggccatgccctctgcgtggacccc
tggggcacagtcctggccgactgcgaggaggtcagcccctgctataagatcgtggagata
tcgcaacagaaactcaaagaagttagaactaatatgcctgttttcagacatagaagacgc
gaagtctactccctctacactttaagtcttcgtaaggagttactccccgcccacaactcc
aatccgcccgcctcagcgtccgccccgccgccctcctccaacgagccaggatacacgttt
ggacatgtcaaagtgccagagacctgtgttttctataagtctgatctgacttatgcgttt
gtaaatttaaggtgtgtgatccctggccatgtcctggtggctcctatccgcatggcggag
cggaacaaggacttgacggaggaggaggctcaagacttctacaaatctatacgaatcgta
caagcgttaatggaaaaagtccacagtgcagactcgtgtacagtcaccatgcaagatgga
agaaacgccggacaaactgttaagcacttacattgccatataatgccgcgaaagaaagga
gattttattgaaaatgatttaatatatttggagttagctaagcacgatcagttcaaaccc
ggtcacccagcgaagccagcccgcacccgtgaagatatggaggcagaagcacaatatcta
agaacggaattagaaaaaatgaataatatgacatacattgacgggaatcgaacagcggaa
aagtttggagacactggatcggctgcggcagtatag

DBGET integrated database retrieval system