KEGG   Trichoplusia ni (cabbage looper): 113502987Help
Entry
113502987         CDS       T05757                                 

Definition
(RefSeq) separin-like
  KO
K02365  separase [EC:3.4.22.49]
Organism
tnl  Trichoplusia ni (cabbage looper)
Brite
KEGG Orthology (KO) [BR:tnl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tnl01002]
    113502987
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tnl03036]
    113502987
Enzymes [BR:tnl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     113502987
Peptidases [BR:tnl01002]
 Cysteine Peptidases
  Family C50: separase family
   113502987
Chromosome and associated proteins [BR:tnl03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Separase
    113502987
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 CHAT
Motif
Other DBs
NCBI-GeneID: 113502987
NCBI-ProteinID: XP_026740569
Position
18
AA seq 680 aa AA seqDB search
MEDFDVFTNEINFTKPLFKNILNKYVYEAPPTPNGPNYQSGRKLMAEECLAVNDDVGCAF
HLSEASAASLRAMAVYRDEQSKSAADKLYKIKSYIKPVQDLVDAHPVPKTEAKLLNLLSD
GTDISRDLEKFSIKDEEPFYRTYLKFSKENNVDNFQKILKEFPKEWTVVQLTVPYNPNEN
LKPLNEYRTDVTSLFLCTYTNDYQDDSVIPPITVHIPANITKEGEKPLFTELYSLLDENY
KTIDNAQFLNNKRLVQNYWSRREDIDLRMKSVINVMDKEWLGGWGCLLTGKLIDKTLKEK
VIKLVDTTISDWGFIRLTQKQRVLLYNLIESCPVLQSQQIKTCIRRILTEYGNSEDVRQV
LNPECGSCTKEFKFLNELCLKCLSKSFEKLHHFSLVDGIRAFSQAVMQIKDNDELKKAKR
HPVILIVDEMLDTFPWETLPILNQHPVSRMENIHFLYYLYKIHEKKICDGYFNAKCDVGR
YVINPEKNLDRMENRMTSFVQYWCPAWSGHVGELPSPNDFISHLTQADIFLYCGHGDGCQ
LGAGGVERARGGALCVLAGCGSVREAAPAPRAPPAAAHHMLHIAGCPMVVGMLWEVTDLE
VDKVISTLLSLFVPSEAPVAWANVGKAKWSHGVLDTSVEQKSPVTPERSLLRAICQARGS
TGYIMIASSVVARGLPVKGI
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atggaggatttcgatgtgtttacaaatgagattaactttacaaagcctctattcaagaac
atactaaacaaatatgtttatgaagcgcctcctacacctaacggacctaactaccagagc
ggtaggaaacttatggctgaagaatgtctggcggtgaacgatgacgtcggctgtgcattc
catttgagtgaggcatcagcagcctctttgagggccatggcagtgtacagagatgagcag
tctaagtctgctgctgataaactgtacaaaatcaaaagctacataaagcctgtgcaggat
ttggttgatgcacatcctgtaccaaaaacagaagcaaagcttttaaacttgttgtcagat
ggcacagatatcagcagagatctagaaaagttctcaatcaaggatgaggagccgttctat
aggacatacctgaaattctctaaagagaataatgttgacaactttcagaagatactgaaa
gaatttcctaaagaatggacagtggtacaactgactgtaccatacaaccctaatgaaaac
ttgaagccattgaatgagtatcggacggatgtgacctctttattcctttgcacatacacc
aacgactaccaggatgacagcgtgataccacccatcactgtgcatatacctgctaatatt
acaaaagaaggagaaaagccactgttcactgagctgtactccctgttggacgagaactac
aaaacgattgataacgcacagttcttgaacaataagcgcttagtacagaactactggagc
cggcgggaggatattgatcttcgtatgaagagtgtaataaacgtgatggataaggagtgg
ctcggcgggtggggttgtttgctaaccggcaagctgatagacaagactttgaaggagaaa
gtcattaaattagttgacaccaccatctcagactggggattcatccggctcactcaaaaa
caaagagtcctactctacaatctaatagaaagttgtccagtgttgcaatcgcaacaaata
aaaacttgtatcagaaggatattaactgagtatggcaattcagaagatgtgagacaagtt
ttaaacccggaatgcggaagttgcaccaaagagtttaagtttttaaatgagttgtgtttg
aaatgcttgtcaaaaagttttgagaagttacatcattttagcttagtcgatggtataagg
gcgttttctcaagctgtgatgcaaattaaggataatgatgaattgaaaaaggctaaaagg
catcctgttatacttattgtagatgagatgctagacacattcccttgggagactttaccc
atactgaaccaacaccctgtatcgcgcatggaaaacatacactttctgtactacctgtat
aaaatacacgagaagaaaatttgtgatggatacttcaatgcgaaatgtgatgttggaaga
tatgttataaatccagagaagaacttggaccgcatggagaacagaatgacctcgttcgtg
cagtactggtgtcctgcgtggagcggccacgtgggcgaactgccctcgcctaacgacttc
atatcgcatctcacgcaggctgatatattcttgtactgcgggcacggtgacggctgccag
ctgggcgccggcggagtggagcgagcgaggggcggcgcgctgtgcgtactggcgggctgc
gggtctgtgcgggaggccgcgcccgcgccgcgagcgccgcccgccgccgcgcaccacatg
ctgcacatagcgggctgccccatggtagtgggtatgctgtgggaagtcacagatctggaa
gtggacaaagtgatcagtacgctgttatccctgttcgtgccttctgaagcgcccgtcgcg
tgggctaacgtgggcaaagctaagtggagtcatggcgtattagacacatcagtagaacag
aagtcgccagtaacaccggagcggtcgttgctgcgagctatctgtcaggcgcggggctca
acgggctatatcatgatcgccagcagtgtggtagcaagggggctgccggttaaaggaata
tga

DBGET integrated database retrieval system