KEGG   Trichoplusia ni (cabbage looper): 113505659Help
Entry
113505659         CDS       T05757                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
tnl  Trichoplusia ni (cabbage looper)
Pathway
tnl00010  Glycolysis / Gluconeogenesis
tnl00562  Inositol phosphate metabolism
tnl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tnl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    113505659
   00562 Inositol phosphate metabolism
    113505659
Enzymes [BR:tnl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     113505659
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     113505659
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708
Motif
Other DBs
NCBI-GeneID: 113505659
NCBI-ProteinID: XP_026744266
Position
2
AA seq 443 aa AA seqDB search
MKVFITSCFLTLIYFMNITIVGSLKSNDIRNHLGSRTPYRFRSNKNDSRIKFPNCKDNKI
WMVIRHGTRLPSKKDIVAGSNLLDLKYEILLQHENGKGPLSKEQLRRLEDWKQEHDVEQE
SYLTLEGQDEMILLAERMQKRFPNAIRERYDNKTFLFRYTATQRTQQSARFFTNGLFEKK
NAQDIIFAPATKVDIVLRFYKHCDRWQKQVKKNPDTYTEQRLYGHSPEMNKTLESVSKRL
GLNRVLNLGEVDTMYKFCGYETSWDKYYISPWCYGFDEETMKVFEYYHDIKTYWVDGYGY
DLSYRQACLSIKNMFENFSDENGPQATFLFTHSGTVLKLLTHMELYRPQAPLTGSYRDDD
RQWKVSQIDCFASNLAFVLYKCKTGDHVLTLHQEKIIKLPMCKHELCPLDHLKKYFKNSI
YNCNYDDMCGLEKKSNATEKTPV
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtatttattacatcttgtttcttgactttaatatattttatgaacataacaatt
gtggggtctttaaaatcaaacgatattagaaatcatttaggctctcgcactccttacagg
tttagatcaaataaaaatgattcaagaattaaatttccaaattgcaaagacaataaaata
tggatggtgattcgacatgggacgaggttacctagtaagaaagacatagtagccggtagc
aatcttttggatttgaaatatgaaatattattgcaacatgaaaatggaaaaggtccacta
agtaaagagcaattaagaaggctggaagattggaaacaggagcatgatgttgaacaagaa
agttacttaaccttagaaggtcaagatgagatgatactccttgctgagaggatgcagaag
cggttccctaatgctatcagagaaagatatgacaacaagacatttctttttcgctacaca
gctacccagagaactcagcaaagcgcaagatttttcaccaatggcttgtttgaaaagaaa
aatgcacaagacattatatttgcaccagcaacaaaggttgacatagtattgaggttttac
aaacactgtgacaggtggcaaaaacaagttaagaaaaaccctgatacatacacggagcaa
aggttatacggtcacagtccagaaatgaacaagacgttggagtctgtgtctaaaaggctg
ggcctaaatagagtactgaatttgggtgaagtggacaccatgtataagttttgtggatac
gaaacgtcgtgggataaatattacatatcaccttggtgctatggatttgatgaagaaacc
atgaaggtgttcgaatactaccacgacataaaaacgtattgggtggatggctatggatac
gacttgtcgtaccggcaagcttgtctatcgatcaagaatatgttcgaaaatttcagtgac
gaaaacggtcctcaagcgacgttcctgttcactcactcgggcactgttctcaagttactc
acacacatggagctgtaccggccgcaagcgccgctcaccggctcctacagagacgacgac
agacagtggaaggtctcacaaatcgactgcttcgcatcgaacttggcttttgtgttgtac
aagtgcaagactggcgatcatgtactgaccctacaccaagagaaaataataaagctgccg
atgtgtaagcacgagctatgcccactagaccacctaaaaaaatacttcaagaactccata
tacaattgtaattacgacgatatgtgtggacttgaaaagaaatcgaacgctactgaaaag
actcctgtttga

DBGET integrated database retrieval system