KEGG   Trichoplusia ni (cabbage looper): 113506476Help
Entry
113506476         CDS       T05757                                 

Definition
(RefSeq) pseudouridine-5'-phosphatase-like
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
tnl  Trichoplusia ni (cabbage looper)
Brite
KEGG Orthology (KO) [BR:tnl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tnl01009]
    113506476
Enzymes [BR:tnl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     113506476
Protein phosphatases and associated proteins [BR:tnl01009]
 HAD phosphatases
  Other HAD phosphatases
   113506476
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_6 Hydrolase_like Hydrolase_3
Motif
Other DBs
NCBI-GeneID: 113506476
NCBI-ProteinID: XP_026745119
Position
17
AA seq 352 aa AA seqDB search
ASASTTVDEVKKVTGFFNQSLLSSTPIQSSDLAAILVTSVIEPHRNLLFPKLTAIKFKYL
QKAVAKIYRVNVEKKITKIGKVSSYDVTFFSRTFLEAQYKPYSGFPRGYCAKRFQRVTHC
LFDLDGTILNSEVTYHKMLKDVCAKYGKRYTKELEKRNYGSTDSEICRNVVKELQLGISP
NQLECEMIELSERTLPKAPLQAGAERLLTHLHDTGIPLALATNSSRRAVRLHAAARPKLF
GMFHHWVCATDPGVDRGKPFPDIYLYAASLFPDKPKPAKCLVFEDSTVGLEAASSAGMQV
VMTPPRHLAPEFSKKATLIIKTLLEFKPEIFGLPPFTGKPEYPTKKHPKMYY
NT seq 1061 nt NT seq  +upstreamnt  +downstreamnt
ttgcatcggcatcgactactgttgacgaggtcaaaaaagtcactggattttttaaccagt
cactcctcagttctactccaatccaatcgtcagacttggcggccatcttggtgacttcag
taatagaacctcaccgcaatttactttttcccaaactgacagctatcaaattcaagtacc
ttcaaaaagcggtggcaaaaatctacagagtaaatgttgaaaaaaaaataacaaaaatag
gaaaagtcagtagctatgatgttacgtttttttcgcgtacgtttctcgaagcgcaataca
aaccatactctggtttcccgagagggtattgcgcaaaacgttttcagagggtcacgcact
gtctgtttgatctagatggaactattctcaattccgaggtaacataccataaaatgttaa
aagacgtctgtgcgaaatatggaaaaaggtatacaaaggaattagagaaacggaactatg
gctcgactgacagtgaaatatgccgcaatgtggtcaaagaattacaacttgggatatcgc
ctaatcagttggaatgtgagatgatcgaactgtcagagaggacgctcccaaaggcacctt
tacaagcaggtgcggagcgcctcctgacccacctccacgacaccgggatcccgctggcgc
tggccaccaactcctcgcggcgggcggtgcggctgcacgcggctgccagacccaaactct
tcggaatgttccaccattgggtatgtgctacggatcccggcgtggaccggggcaagccct
tccccgacatctacctgtacgccgcctccctgttcccggacaaaccgaaacccgcaaagt
gtctggtcttcgaagattcgaccgtcgggttagaagcagcttcctccgccggaatgcagg
tcgtcatgacaccacctagacatcttgcaccggagttttctaaaaaagcgaccctcatca
tcaagactctcctggaattcaaacctgaaatattcggactacccccatttactgggaaac
cagagtaccctacgaaaaagcatccaaaaatgtactattag

DBGET integrated database retrieval system