KEGG   Trichoplusia ni (cabbage looper): 113508050Help
Entry
113508050         CDS       T05757                                 

Definition
(RefSeq) glutathione S-transferase 1-1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
tnl  Trichoplusia ni (cabbage looper)
Pathway
tnl00480  Glutathione metabolism
tnl00980  Metabolism of xenobiotics by cytochrome P450
tnl00982  Drug metabolism - cytochrome P450
tnl00983  Drug metabolism - other enzymes
tnl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tnl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    113508050
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    113508050
   00982 Drug metabolism - cytochrome P450
    113508050
   00983 Drug metabolism - other enzymes
    113508050
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tnl02000]
    113508050
Enzymes [BR:tnl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     113508050
Transporters [BR:tnl02000]
 Other transporters
  Pores ion channels [TC:1]
   113508050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_C GST_C_2 GST_N_3 GST_N GST_N_2
Motif
Other DBs
NCBI-GeneID: 113508050
NCBI-ProteinID: XP_026746816
Position
Unknown
AA seq 186 aa AA seqDB search
MNPQKEIPVLDDDGFFLSESVAIMQYICDKYKPGSSLYPTDPKARAIVNQRLLFNLTTYY
ANVAPYTMAPIFFAYERTPEGLKRVHMALEVFETYLTRLGSSYAAGDQLTIADFPLINTT
MTLEAVGVDFSKYAKINQWYNNFKNNHPDLWKISAAGMKEIKHFDANPPDLSHLNHPIHP
ARKQKA
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaacccccaaaaagaaatccctgtattggacgatgacgggttcttcttgagcgagagt
gtcgctattatgcagtacatttgcgataaatacaagccagggtcatctttgtaccccacg
gatccgaaagccagggccattgttaaccaacgtctgctgtttaacttgacgacttattac
gctaatgtagcaccttacacgatggcccctatcttcttcgcttacgagcgtaccccagaa
ggcttgaagcgagtccacatggctttagaagtattcgaaacctatctcacacgtctaggc
tccagctacgccgccggtgaccagttgaccatcgcagatttccctctcattaacactacc
atgaccctagaagccgttggtgtggacttctcgaaatatgctaagataaaccaatggtat
aataacttcaagaataatcatccggacttatggaagatctcagcagccggcatgaaagag
atcaaacacttcgacgctaacccaccggacttgtctcatcttaatcatcccattcatccg
gctaggaaacaaaaagcctaa

DBGET integrated database retrieval system