KEGG   Trichoplusia ni (cabbage looper): 113508906Help
Entry
113508906         CDS       T05757                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase-like
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
tnl  Trichoplusia ni (cabbage looper)
Pathway
tnl00510  N-Glycan biosynthesis
tnl00513  Various types of N-glycan biosynthesis
tnl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tnl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    113508906
   00513 Various types of N-glycan biosynthesis
    113508906
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:tnl01003]
    113508906
Enzymes [BR:tnl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     113508906
Glycosyltransferases [BR:tnl01003]
 Glycan extension
  N-Glycan
   113508906
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2
Motif
Other DBs
NCBI-GeneID: 113508906
NCBI-ProteinID: XP_026747877
Position
3
AA seq 539 aa AA seqDB search
MPRLKYASIARVVVILGLFCLWLQIMLSASSGGMYREGDLDHDITLQGLLLNVYLTKHEE
GYVVTTENIVESNGQEIYEEELMNANDTSEQVLALVPPELHKYLTVHTKNNTANSTEKIY
KNITDIKRAIQRCNEAQLIHNEDIFGPVQNDTIIIAIQVHTRLTYLRHLIVSLAQAKEID
RTLLIFSHDYYDEEINALVRSIDFTKVMQIFYPYSIQTHPNEFPGMDPNDCPRDTKFDQA
IKLKCNNALYPDLHGHYREAKYTQTKHHWWWKANRIFNQLQSTAGHTGMVVFLEEDHYVA
EDFIHMLGLLKSTADKSCPQCEILSLGTYLKTYQYHVNGDKRKKNLNMNYIQQVKAANEE
RRKKHEGQSWNFQVYPNLYGMTQKVEITPWHXSMHNMGFAFNRTVWSNIMVLQDQFCAYD
DYNWDYSLLHLSQNRPGREKFKVIMCKGPRVFHIGECGFHHKKSNCNASTVISKVQKLLL
NAKPYMFPTRVSATVTAGGAKHNKKLVKGNGGWGDIRDQELCANMTRIGRQARKNIYYA
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgccacggttaaaatatgcgtcgatcgcacgtgtggttgttatactcggcctcttctgc
ctatggctccagatcatgctgtcggcatccagtgggggcatgtacagagagggagattta
gatcatgacattacgttacaaggactcttgttgaacgtttacttgacaaaacatgaagag
ggttatgtagtaacaacagaaaatatagtagaatcgaatgggcaagaaatatatgaagaa
gagctgatgaatgccaacgacacatcggagcaagtgttagctttagtgcctccggagtta
cataaatatttgactgtccatactaagaataatacagcaaattcaaccgagaaaatctac
aagaatataacagatattaagagggcgatccaaagatgcaatgaagcccaacttattcac
aacgaggacatcttcggaccggtccaaaatgacacgatcatcatagccatacaggtccac
acccgcctgacgtacctccgccacctgatagtgtctctcgctcaagcaaaagagatagac
aggactcttctcatcttctcccacgactattacgatgaagagatcaacgctctcgtcaga
agtattgattttaccaaggtgatgcaaattttctacccgtattcaatacaaacacatcca
aatgagtttccggggatggatccaaacgattgtccgcgagacacgaagtttgatcaggca
ataaaactaaaatgcaacaacgcgttatacccggacctacacgggcactaccgggaggcg
aagtacactcagactaaacaccactggtggtggaaagcgaacaggatattcaatcagctg
cagagtaccgctggacatacaggtatggtcgtctttctagaagaagaccattacgtagca
gaagacttcatacacatgctcggtcttctcaagtctacggcagacaagagttgtcctcaa
tgtgaaatcctctccctgggaacgtatctcaaaacgtaccagtatcacgtgaacggtgat
aagaggaagaagaatttgaacatgaattacatacagcaagtgaaggccgcgaacgaagaa
cgaaggaagaagcacgaaggacaatcctggaatttccaagtctaccccaacttatacggg
atgacgcaaaaggttgaaataactccatggcatntcagcatgcataacatgggtttcgct
ttcaataggaccgtttggagcaatataatggtgttgcaagaccaattttgtgcctatgat
gattacaattgggactattcgctgttacacctgtcacagaataggccgggacgggagaag
tttaaagttatcatgtgtaaggggcctagggtttttcatattggtgaatgtggctttcac
cacaagaagtctaactgcaacgcgtccacagttataagcaaagtgcagaagttacttctg
aatgctaagccgtacatgttcccgacgcgggtgagcgcgaccgtcaccgccggcggtgcg
aagcataataagaagttggtgaagggaaacggagggtggggtgatattagagatcaagag
ttatgtgcaaatatgacaagaattggacgacaagcgagaaaaaacatatactatgcataa

DBGET integrated database retrieval system