KEGG   Thermotoga naphthophila: Tnap_0010Help
Entry
Tnap_0010         CDS       T01139                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
tnp  Thermotoga naphthophila
Brite
KEGG Orthology (KO) [BR:tnp00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Tnap_0010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ADA66118
UniProt: D2C582
Position
complement(9753..10682)
Genome map
AA seq 309 aa AA seqDB search
MFILLLPSLFLGWSLGANDAANVFGPFVGSGLISYRKATIVASIFVILGSVLGGARGLQN
ISSLSTSDLLLSSIAVLSGALTVTIMTKLGIPVSTSQAVVGGIIGANVTVMGIGGIDFSA
LTKILTVWFLTPVGAFFLSLIFYPALSFLFRRIPSIQIQDRVIKISAWIIGAYGAFSLGA
NNVANVTGVFAGKILTIEQAAFLGGISIAIGILTYSKNVMLTVRKNLIELDHFTSLIAVL
SQAMVVWIFSLIGIPVSSSQAIVGAVLGAGYSKGMNLGNKKVLIRILSGWFLTPAVSGTL
SFLLTSLIK
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
ttgttcatactccttttgccttctctctttctgggatggtcgctgggtgccaacgatgcg
gcgaacgttttcggtcctttcgtaggatctggtctcatttcttacagaaaagccaccata
gtggcgagcattttcgtgattctgggttctgttcttggaggagcgagagggcttcagaat
atcagttctctgagcacttccgatttacttctctccagtatcgctgttctttcgggcgct
ctcacagtcacgatcatgacaaagcttgggatacccgtttccacatctcaagctgtggtc
ggaggcataataggagccaatgtcacggtaatgggcattggtggaattgatttttctgca
ctcacgaaaatacttactgtgtggtttttaacaccagttggagcgtttttcttgagcctc
atcttctatccagctctttcgtttctcttcaggagaattcccagcattcaaattcaagac
agagtaataaaaatttccgcgtggatcataggtgcttacggtgcgttttccttgggagcg
aacaacgtcgcaaacgtaacaggagtgttcgccggaaagatcctgacgatcgagcaagca
gcctttctgggaggaatcagtatagccatcggaattctcacctacagtaaaaacgtgatg
ctgacggtgaggaaaaatctaatagaattagatcactttacttctcttatagcggtttta
tcacaggcaatggttgtgtggattttcagcttgataggaatcccagtttcttcatctcag
gccattgtgggagccgttctgggagctggttattcaaagggtatgaatctgggaaataag
aaagttttaataaggattttgagtgggtggtttttaacccccgcagtttccggtaccctt
tcttttttgttgacatctctgataaaataa

DBGET integrated database retrieval system