KEGG   Thermotoga naphthophila: Tnap_0768Help
Entry
Tnap_0768         CDS       T01139                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tnp  Thermotoga naphthophila
Pathway
tnp00260  Glycine, serine and threonine metabolism
tnp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tnp01100  Metabolic pathways
tnp01110  Biosynthesis of secondary metabolites
tnp01130  Biosynthesis of antibiotics
tnp01230  Biosynthesis of amino acids
Module
tnp_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tnp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tnap_0768
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tnap_0768
Enzymes [BR:tnp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tnap_0768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Cas_APE2256
Motif
Other DBs
NCBI-ProteinID: ADA66862
UniProt: D2C7C6
Position
complement(794176..795345)
Genome map
AA seq 389 aa AA seqDB search
MKGYFGPYGGQYVPEILMPALEELEAAYEGIMKDGSFWREFNDLLRDYAGRPTPLYFARR
LSEKYNARIYLKREDLLHTGAHKINNAIGQVLLAKRMGKTRIIAETGAGQHGVATATAAA
LFGMECVIYMGEEDTIRQKPNVERMKLLGAKVVPVKSGSRTLKDAINEALRDWITNLQTT
YYVIGSVVGPHPYPIIVRNFQKVIGEETKKQILEKEGRLPDYIVACVGGGSNAAGIFYPF
IDSGVKLIGVEAGGEGLETGKHAASLLKGKIGYLHGSKTFVLQDDWGQVQVTHSVSAGLD
YSGVGPEHAYWRETGKVLYDAVTDEEALDAFIELSRLEGIIPALESSHALAYLKKINIKG
KVVVVNLSGRGDKDLESVLNHPYVRERIG
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggttactttggtccttacggaggtcagtacgttcccgagattctcatgcctgcc
cttgaagaactcgaggcggcttacgagggaatcatgaaggatggatcgttctggagagag
ttcaacgaccttctaagggattacgctggacgccccactcctctttacttcgccagaagg
ttgagtgaaaagtacaacgccaggatttatttgaagcgtgaagatcttcttcacacaggt
gctcacaagataaacaacgccataggtcaggtgcttctcgcgaagaggatgggaaaaaca
agaataatagcggaaacaggagcggggcagcacggcgttgccaccgcgacggccgctgcg
ctctttggaatggagtgcgtcatatacatgggcgaagaagacacgatcagacagaaaccc
aacgttgagagaatgaaactcctcggcgcgaaagtggttcccgtgaagagcggaagcaga
acgctgaaagacgccataaacgaagcccttcgggattggatcacgaaccttcagaccacc
tactacgttatcggatccgtcgtgggacctcacccgtatccgatcatagtgagaaacttt
cagaaggtgattggtgaggaaacaaaaaagcagatccttgagaaggaagggagattgccg
gattacatcgttgcgtgtgttggaggaggaagcaacgctgccggtatcttctacccgttc
atagattccggtgtgaagctgatcggagtggaagccggtggagaaggcctcgaaaccgga
aagcacgcagcttctcttctcaaagggaaaattggatacctacacggaagtaagaccttc
gttcttcaggatgactggggccaggttcaggtgacacactcggtttcggcgggactggac
tattccggtgtggggcctgaacacgcttattggagggagactggaaaagttctgtacgat
gcggtgacggatgaagaagctctcgatgccttcatcgaactttcaaggctggaagggatc
attccagcactcgaaagctctcacgcactggcttacctgaagaagatcaatataaagggt
aaggtcgtcgttgtgaacctttcagggcgcggcgacaaggatttagaatcagttttgaac
catccgtacgtcagggagaggataggatga

DBGET integrated database retrieval system