KEGG   Thermotoga naphthophila: Tnap_0770Help
Entry
Tnap_0770         CDS       T01139                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
tnp  Thermotoga naphthophila
Pathway
tnp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tnp01100  Metabolic pathways
tnp01110  Biosynthesis of secondary metabolites
tnp01130  Biosynthesis of antibiotics
tnp01230  Biosynthesis of amino acids
Module
tnp_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tnp00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tnap_0770
Enzymes [BR:tnp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Tnap_0770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS DUF1877 DUF4962
Motif
Other DBs
NCBI-ProteinID: ADA66864
UniProt: D2C7C8
Position
complement(795953..796711)
Genome map
AA seq 252 aa AA seqDB search
MRRLWEIVEAKKKDILEIDGENLIVQRRNHRFLEVLSGKEKVKIIAEFKKASPSAGDINA
DASLEYFIRMYDELVDAISILTEKHYFKGDISFVKAARALTCRPILAKDFYIDKVQVKLA
SSVGADAVLIIARILTAEQIKEIYEAAEELGMDSLVEVHSREDLEKVFSVIRPKIIGINT
RDLDTFEIRKNVLWELLPLVPDDTVVVAESGIKDPRELKDLRGKVNAVLVGTSIMKAENP
RRFLEEMRAWSE
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atcagaagactctgggaaatagttgaagccaaaaagaaagatattctggagatagacggc
gagaacttgatcgttcaaagaagaaaccacagatttctggaggttctgtcgggaaaagag
aaagtaaagatcatagcggaattcaagaaggcttctccatctgctggagatataaacgct
gatgcttctctggaatatttcataaggatgtacgacgagctggtggatgcgatcagcatc
ctcacggaaaagcattatttcaaaggagatatttctttcgtaaaagcagcgagggccttg
acctgcagacccattctcgctaaggacttctacatagacaaggtccaggtgaaactggct
tccagtgtgggagcagacgccgttcttattatcgcccgaatactcactgcagagcagata
aaagagatctatgaagcggcggaagagctcggaatggacagtctcgtagaagtccactcc
agagaagatctggagaaggtcttttcggtgatcagaccgaagataatcggtatcaacacg
agagatctggacactttcgagataaggaagaatgtgctgtgggaacttctaccactcgtg
ccggatgatacggttgtggtcgctgaaagtggcataaaagatcccagagaactcaaggat
ctgcgggggaaggtgaacgctgttctcgttggtacatccatcatgaaagccgagaatcca
agaagatttctggaagagatgagagcatggtcagagtga

DBGET integrated database retrieval system