KEGG   Thermotoga naphthophila: Tnap_1040Help
Entry
Tnap_1040         CDS       T01139                                 

Definition
(GenBank) phosphonopyruvate decarboxylase-related protein
  KO
K15635  2,3-bisphosphoglycerate-independent phosphoglycerate mutase [EC:5.4.2.12]
Organism
tnp  Thermotoga naphthophila
Pathway
tnp00010  Glycolysis / Gluconeogenesis
tnp00260  Glycine, serine and threonine metabolism
tnp00680  Methane metabolism
tnp01100  Metabolic pathways
tnp01110  Biosynthesis of secondary metabolites
tnp01120  Microbial metabolism in diverse environments
tnp01130  Biosynthesis of antibiotics
tnp01200  Carbon metabolism
tnp01230  Biosynthesis of amino acids
Module
tnp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tnp_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tnp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tnap_1040
  09102 Energy metabolism
   00680 Methane metabolism
    Tnap_1040
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tnap_1040
Enzymes [BR:tnp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     Tnap_1040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhosphMutase Metalloenzyme
Motif
Other DBs
NCBI-ProteinID: ADA67127
UniProt: D2C841
Position
complement(1078269..1079474)
Genome map
AA seq 401 aa AA seqDB search
MFDKQEFVSKLVTEEKAKIVLLVMDGLGDIPVNGKTPLQAANTPNLDNLAKESDLGQTIP
VLPGITPGSGPGHLSLFGYDPIRYQIGRGILEALGIGVEVGEKDVVARANFATWDGKVVL
DRRAGRPATEESSKVVQLLSEKIKKIEDVEITFYPGKEHRFVVKFTGEGLGDNVTDADPQ
KEGHPMVWAEGLDEPSKKTARITNELIKKIAEVLKDNPKINFALIRGFSKYPDLPKFPQV
YKMKAGAIATYPMYRGLAKLVGMEIIETGQTVADEIKTLKERWNDYDFFYVHVKKTDSYG
EDGKFEEKVKVIEEVDALIPEIVSLNPDVLVITGDHSTPVPLKAHSWHPVPLLIWSKYTR
RGLSQAFNEFECARGTLGTIHASDVMTLALAYAGKLEKFGA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgttcgataaacaggagttcgtgtcgaaactcgtcacagaagagaaggcaaagatcgtt
ctacttgtgatggatggccttggagacatccccgtgaatggaaaaacaccccttcaggct
gcaaacactccgaatctggacaacctagcaaaagaaagtgatcttgggcagacgataccc
gttcttcccggaatcaccccgggcagtggaccaggacatctttcactgttcggatacgat
cccataaggtaccagattggaagaggaatactcgaagctctcggcataggtgttgaggta
ggggaaaaagacgtcgttgcaagggcgaattttgccacctgggatggaaaagtggtcctc
gacagaagagccggaaggcctgccacagaagaatcctccaaggtggttcagctgctctcg
gaaaagataaagaaaatcgaagacgtggagatcactttctaccctggaaaggaacacaga
ttcgttgtgaaattcacaggagaagggctcggagataacgtgacagatgcagatccccag
aaagaaggacatcccatggtctgggcagaaggtctggacgaaccttcgaaaaaaacggca
aggatcaccaacgagttgatcaaaaagatagcggaagtcctgaaagacaatccgaagata
aacttcgccctcatcagaggtttttccaagtacccggatcttccgaaattccctcaagtt
tacaagatgaaagcgggagccatagcaacgtacccgatgtacagaggtcttgcaaagctc
gtgggaatggagataatagaaacgggccagactgtagccgacgagataaaaacgctgaag
gaaagatggaacgactacgacttcttctacgtccacgtgaagaaaaccgactcttacggt
gaggatggaaaattcgaagaaaaggtgaaggtgatagaagaggtcgatgcgctcattcca
gagatagtttctctgaatcccgacgttcttgtgatcacgggtgatcattccactcccgtt
ccgctgaaagcacacagctggcatcccgtacctcttctcatctggtcgaagtatacaaga
agaggtctttctcaagctttcaacgagttcgaatgcgcgaggggcacactcggaacgatc
cacgcaagcgacgtcatgacactggctctcgcgtacgccggaaagctggaaaaattcgga
gcatga

DBGET integrated database retrieval system