KEGG   Thermotoga naphthophila: Tnap_1117Help
Entry
Tnap_1117         CDS       T01139                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
tnp  Thermotoga naphthophila
Pathway
tnp00230  Purine metabolism
tnp01100  Metabolic pathways
Module
tnp_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tnp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Tnap_1117
Enzymes [BR:tnp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Tnap_1117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_22 AAA AAA_18 RsgA_GTPase AAA_16 Rad17 ABC_tran ATPase_2 AAA_23 AAA_24 AAA_14 AAA_5 MobB NTPase_1 cobW ATP-synt_ab AAA_19 Thymidylate_kin AAA_30 Zeta_toxin RNA_helicase AAA_15 MMR_HSR1 AAA_29 Clathrin_H_link AAA_11
Motif
Other DBs
NCBI-ProteinID: ADA67204
UniProt: D2C8B8
Position
1153155..1153778
Genome map
AA seq 207 aa AA seqDB search
MKGQLFVICGPSGAGKTSIIKEVLKRLDNVVFSVSCTTRPKRPHEEDGKDYFFITEEEFL
KRVERGEFLEWARVHGHLYGTLRSFVESHINEGKDVVLDIDVQGALSVKKKYSNTVFIYV
APPSYADLRERILKRGTEKEADVLVRLENAKWELMFMDEFDYIVVNENLEDAVEMVVSIV
RSERAKVTRNQDKIERFKMEVKGWKRW
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggacagcttttcgtcatctgtggtccttccggtgcggggaaaaccagtataatc
aaagaagttctcaaaagactggacaacgtagttttctccgtttcctgcacgacaaggccg
aagcgccctcacgaggaggatggcaaggattatttcttcatcacggaagaagagtttttg
aagcgtgtcgaaagaggggagttcctcgagtgggcccgtgtccacggccatctctatggg
acccttcgctcctttgtggaatctcatatcaacgaaggaaaggatgttgtactcgacata
gacgttcagggtgcgctctcggtaaagaagaaatactcaaacacggtgttcatttacgtg
gctcctccatcctatgcggatctgagggaacgtatcctcaaaaggggaacggagaaagaa
gcagacgtgcttgtaagactcgaaaacgccaagtgggagctcatgttcatggatgagttc
gattacatcgttgtaaacgaaaatctcgaagatgctgtagagatggtcgtgtcgattgtg
aggtccgagagagcgaaagtcaccagaaatcaagacaagatagaacggttcaagatggag
gtgaaaggatggaaaagatggtga

DBGET integrated database retrieval system