KEGG   Thermodesulfobium narugense: Thena_0472Help
Entry
Thena_0472        CDS       T01488                                 

Definition
(GenBank) protein of unknown function DUF100
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
tnr  Thermodesulfobium narugense
Pathway
tnr00010  Glycolysis / Gluconeogenesis
tnr00030  Pentose phosphate pathway
tnr00051  Fructose and mannose metabolism
tnr00680  Methane metabolism
tnr01100  Metabolic pathways
tnr01110  Biosynthesis of secondary metabolites
tnr01120  Microbial metabolism in diverse environments
tnr01130  Biosynthesis of antibiotics
tnr01200  Carbon metabolism
tnr01230  Biosynthesis of amino acids
Module
tnr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tnr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thena_0472
   00030 Pentose phosphate pathway
    Thena_0472
   00051 Fructose and mannose metabolism
    Thena_0472
  Energy metabolism
   00680 Methane metabolism
    Thena_0472
Enzymes [BR:tnr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Thena_0472
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Thena_0472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: AEE14112
UniProt: M1E4F8
Position
475914..476762
Genome map
AA seq 282 aa AA seqDB search
MKIRLDILKFDVSGYVDNISVHPVVVEKLECFFSNLVSENEVLDYNVLALANKVLIIVVT
DAERFKEANDIDKILYSVIENIEKADFNFTLEKSSIKQFKNFFFTERKNEGILIFFSTNV
EVVSHNIAILKLLFDPFTNVNIFKADISKLYTINLQFNERLKSYIQFKDLFKLVKDMKKS
NLKFFVQSIESQNSEPVMASLEDGSVSLWRVSEPFFHINLILRALVENTLPVTFYDSSNA
LAFPKSLAVGFTLQNGKLFGPVDLFDDSFYESLRSKFYEKNY
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaattaggttagacatccttaagtttgacgtgtcaggttatgttgataacataagc
gtgcatcctgtagtggttgagaagttggagtgctttttctcaaatttagttagtgaaaat
gaagttcttgactacaacgtattggctcttgcgaacaaagttttaataatagtggttacg
gatgccgaaaggttcaaagaagccaatgacattgataagattttgtacagtgtaatagaa
aatatagaaaaggctgattttaattttacgcttgaaaaatctagcattaaacaatttaaa
aatttctttttcacagaaagaaaaaatgagggtatattaatattcttttcaactaatgtt
gaagttgtatctcacaatatagcaatattgaagctattgttcgatccttttacaaatgtg
aatatctttaaagctgatatttctaaactatataccatcaatttgcaatttaatgagcgc
ttgaaatcttatattcaatttaaagatctttttaaattagtaaaggatatgaagaaatcg
aatttaaaattttttgttcaatcaattgagagtcaaaattctgagcccgtgatggcatct
cttgaagatggaagcgtttccttgtggagggtgtctgagccattttttcatataaacctt
attttaagagctttagttgaaaatactttgcctgtgactttctatgattcatctaacgct
ttagcttttcccaagtcattggctgtgggtttcactctccaaaatggaaaactttttggc
cctgttgatctatttgatgactctttttacgaatctttaagaagtaaattctatgaaaaa
aattattga

DBGET integrated database retrieval system