KEGG   Thermodesulfobium narugense: Thena_0509Help
Entry
Thena_0509        CDS       T01488                                 

Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
tnr  Thermodesulfobium narugense
Pathway
tnr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:tnr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Thena_0509
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tnr03011]
    Thena_0509
Ribosome [BR:tnr03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Thena_0509
  Bacteria
    Thena_0509
  Archaea
    Thena_0509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AEE14149
UniProt: M1E7U5
Position
507924..508283
Genome map
AA seq 119 aa AA seqDB search
MEVRAVSKYVRISPKKVQEIIHLLPGKQVDVALNSLSVMPHKAARILYKVTKSAVANAEN
NFNLDRKDLIVSKAFADKGPSMKRFTPRAYGRAFPILKRTSHITVVVATAESKQKGGKQ
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atggaagttcgagctgtatcaaaatatgttcgaatatcaccaaagaaggtacaagaaatt
attcatctgcttcctggcaagcaagttgacgttgctttgaatagtttgagtgttatgcct
cataaagctgcacgtattctttataaggttacaaaatccgctgtagcaaatgcagagaat
aatttcaatctggataggaaagatttaatagtttctaaagcttttgctgataaagggcca
agcatgaaaagatttaccccaagagcatatgggcgtgcttttccaatattgaaaagaacc
tcacatattactgtagtagtagctactgctgaatctaaacaaaaaggaggcaaacaataa

DBGET integrated database retrieval system