KEGG   Thermodesulfobium narugense: Thena_0715Help
Entry
Thena_0715        CDS       T01488                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
tnr  Thermodesulfobium narugense
Pathway
tnr00900  Terpenoid backbone biosynthesis
tnr01100  Metabolic pathways
tnr01110  Biosynthesis of secondary metabolites
tnr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tnr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Thena_0715
Enzymes [BR:tnr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Thena_0715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXPR_C DXP_reductoisom Semialdhyde_dh DapB_N P22_AR_N
Motif
Other DBs
NCBI-ProteinID: AEE14349
UniProt: M1E8A1
Position
691865..692995
Genome map
AA seq 376 aa AA seqDB search
MKKIILIGSTGSIGTQALEVVRKHSDKLKVVGLAARKISEKLRDQIREFQPECVGLLYKE
DFETKPEKTFYGFDGILEMVRQTEADLVLLAWVGKDSIYIAKSALDSNKDLAFATKEILV
YGGNLIVNYAKKVGRKILPVDSEHNAIFQLLENEDISFVDSIYLTASGGPFYNKHFIKSP
SVDEVLSHPTWKMGPKVTVDSANLMNKGFEVIEASFLFGFDPSKIKVLINRTSLVHSLIS
FLDGSVRILYYKPDMRIPIQHVLSYPERWVAPQKEDFENHFVLEFEKPNNNEFPCLALAY
EALEGGSIKTASLAACDEVLVDAFLNKKISFLSIPKMLELILSKSNSGNVTSFEEIDLIY
NETVARSLELLEAYKI
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaataattttgattggatctacaggatcaataggcacgcaagctttagaagtt
gttagaaaacattctgataaattaaaagtagtaggtttagcagcaagaaagatatcagaa
aaattaagagatcaaattcgggaatttcaacctgaatgtgttggcctattgtataaagaa
gattttgaaactaagcctgagaagacattttatggttttgatggaatcttagaaatggta
agacaaacagaagctgacttagttttgctagcttgggtaggcaaagattcgatatatatt
gctaaatcagcgcttgactcaaataaagatcttgcttttgctacaaaggaaatacttgtt
tatggtggaaatttaattgttaattatgcaaaaaaagttggcagaaaaattttacctgta
gacagtgaacacaacgcaatctttcaactattagaaaacgaagatatttcttttgttgat
tctatatatctgacagcttcaggagggccattctataacaagcattttatcaaaagtcct
tcagtggatgaagttttgtcgcatcctacatggaaaatgggaccaaaggtaactgttgat
tctgctaatctgatgaataaaggttttgaagtaatagaagcctcttttctttttggtttt
gatcctagtaagattaaggttcttattaatagaactagtttggttcactctttgatttca
tttcttgatggttctgttagaatcttgtattataaaccggatatgcgaatacctatacag
catgtactctcttatcctgaaagatgggttgctcctcaaaaagaagattttgaaaatcat
ttcgtgttggaatttgaaaagcctaataataatgagttcccatgcctggctcttgcttat
gaagcgttggaaggtggttcaattaaaactgcatcgcttgctgcttgtgatgaagttttg
gttgatgcatttttaaataaaaagatttcatttttaagcatcccaaaaatgttagaattg
atcttatcaaaatctaattcgggtaatgttacatcttttgaagagatagatttgatttat
aatgaaactgttgcgagaagtttagagttgttggaggcctataaaatttaa

DBGET integrated database retrieval system