KEGG   Thermodesulfobium narugense: Thena_1015Help
Entry
Thena_1015        CDS       T01488                                 

Definition
(GenBank) Acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tnr  Thermodesulfobium narugense
Pathway
tnr00010  Glycolysis / Gluconeogenesis
tnr00620  Pyruvate metabolism
tnr00640  Propanoate metabolism
tnr00680  Methane metabolism
tnr01100  Metabolic pathways
tnr01110  Biosynthesis of secondary metabolites
tnr01120  Microbial metabolism in diverse environments
tnr01130  Biosynthesis of antibiotics
tnr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tnr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thena_1015
   00620 Pyruvate metabolism
    Thena_1015
   00640 Propanoate metabolism
    Thena_1015
  Energy metabolism
   00680 Methane metabolism
    Thena_1015
Enzymes [BR:tnr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Thena_1015
Lipid biosynthesis proteins [BR:tnr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Thena_1015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEE14644
UniProt: M1E8S0
Position
complement(1015476..1017437)
Genome map
AA seq 653 aa AA seqDB search
MSIEAKNETLNMIKESKIIFPNKDKVKNTNAGSIDAFNNLLKRSWDEPEKFWEDVANELS
WFHPWSKTIEGEFPNFKFFTGGITNPAFNMLDRNIEKGYANKLALIWEGENYETKFYTYK
MLLCEVNKFCNVLKGFGLKKGDRVSIYLPNLAETVIAVLACYRMGVLFNTVFSGFSANAL
RERLNHFEPQVFITADGIYRRGKVIALKEQADIAIEKVSSIKASIVVKRGGNPISMKSGR
DYWWDDLMRKSEAEFQPELIEANEPGLVFYTSGTTGKPKGVVHSGNAFVINNYIYAKYHL
DLHQDDVFWCMADIGWLTMHIWGIVGALSNGITTIFYEGAIDYPEQDRVYQILEKYRVNK
WWTSPTATRMLMKFGEEKLKPYDLSSLDVVAFVGEPLNPEAWKWVYEKIGKGKIYLNNTY
GQTETAGCPLAGAAWLTPMKPGSCGIQFLGAQLDIVDDFGNPVEPMTVGNLVFKKPIPML
IRDLWKDHERYLDTYFYKVPGTYFTYDAAVRDNDGHIWVLSRTDDVINVSGHRISTMEIE
SAVMEVEGVVESAVIGSPDEVKGMMPVVFVTVRDENNEEEIINKIKLKIVEKIGKIALPK
DVFCVPTTPKTPSGKIMRRFLRELVIKGKIVSDTTSLENPDSIEIISKIISGI
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgtctattgaagctaaaaatgagactttaaatatgattaaagaaagtaaaataatattt
ccaaataaagataaagttaaaaataccaatgcaggcagcattgatgcctttaataattta
ttaaaaaggtcctgggatgaaccagaaaaattttgggaagatgtagcaaatgaattgtcc
tggtttcacccatggtcaaaaacaattgaaggagaatttccaaactttaagttttttaca
ggggggataacaaatccagcttttaatatgttagatagaaatattgaaaagggatatgca
aataagcttgcacttatatgggaaggcgaaaattatgaaacgaagttttatacctataaa
atgcttctttgtgaagttaataaattttgtaatgttttaaaaggctttggtttgaaaaaa
ggtgatagagtctcaatttatcttccaaacctagctgagacagttattgctgttcttgct
tgctatagaatgggagttttatttaataccgtattttctggtttttctgccaatgcactt
agagaaaggctaaatcactttgagccacaagtatttattacagcagatggaatttataga
agaggtaaggttattgctctcaaagaacaggctgacattgcaattgaaaaggtaagtagt
ataaaagcctcaattgttgttaaaagaggcggaaaccctataagtatgaagtcaggtagg
gattattggtgggatgatttaatgagaaaatctgaagctgaatttcagccagaacttatt
gaagcaaatgaacctggtttggttttctatactagtggtaccactggtaaaccgaaaggc
gtagttcattcgggtaatgcttttgtaataaacaactatatttatgctaaatatcattta
gatttgcatcaagatgatgtcttttggtgtatggctgacattggatggttgacaatgcat
atttggggtatagttggtgcattgtcgaatggtataacaactattttttatgaaggagca
atagattatccagaacaggatagagtttatcaaattttggaaaagtatagagttaacaag
tggtggacttctccaactgctactagaatgttgatgaaatttggggaagaaaaattgaag
ccttatgatctaagttcattagatgtagttgcttttgtgggagaacctttaaaccctgaa
gcttggaaatgggtttatgaaaaaattggaaaaggtaagatatatctaaataatacttat
ggccaaacagaaactgccggatgtcctttagcaggtgctgcatggcttacccctatgaaa
cctggttcatgtggtattcaatttttgggagcacaattagacatagttgatgattttggt
aacccagtagaaccaatgacagtaggaaatctagttttcaaaaaaccaataccaatgttg
attagagatctttggaaagatcatgagagataccttgatacttatttttataaagtgcca
ggtacatattttacatatgatgctgctgtgagagataatgatggccatatatgggtgctt
tctagaactgatgacgttataaacgtatcagggcatagaattagtactatggagattgaa
agcgcagttatggaagttgaaggagtagtagagtcggctgtaataggaagtcctgatgaa
gtaaaaggtatgatgcctgttgtttttgttacagttagagatgaaaataacgaagaagaa
attataaataaaataaaattaaaaattgttgaaaaaattggcaaaatagctcttcctaaa
gatgttttttgtgtcccaactactccgaaaactcctagcggaaagattatgagaagattt
ttaagagaattggttattaaaggtaagattgtaagcgatactacaagtttggagaatcct
gatagcatagaaattatcagtaaaataatttcagggatctaa

DBGET integrated database retrieval system