KEGG   Thermodesulfobium narugense: Thena_1402Help
Entry
Thena_1402        CDS       T01488                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tnr  Thermodesulfobium narugense
Pathway
tnr00010  Glycolysis / Gluconeogenesis
tnr00052  Galactose metabolism
tnr00500  Starch and sucrose metabolism
tnr00520  Amino sugar and nucleotide sugar metabolism
tnr00521  Streptomycin biosynthesis
tnr01100  Metabolic pathways
tnr01110  Biosynthesis of secondary metabolites
tnr01120  Microbial metabolism in diverse environments
tnr01130  Biosynthesis of antibiotics
tnr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tnr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thena_1402
   00052 Galactose metabolism
    Thena_1402
   00500 Starch and sucrose metabolism
    Thena_1402
   00520 Amino sugar and nucleotide sugar metabolism
    Thena_1402
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Thena_1402
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Thena_1402
Enzymes [BR:tnr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Thena_1402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase
Motif
Other DBs
NCBI-ProteinID: AEE15017
UniProt: M1E5D7
Position
complement(1448825..1449835)
Genome map
AA seq 336 aa AA seqDB search
MFNFYKIIKIIYNIDMADITQFDYYIGIDIGGTRTRVGRFSRSFKLEEKEVIETFRYKDN
PKLLLEEIAKKILSLKKPNSKFAIGISAPGPCDTKLGIVKDPPNLPGWGEVRVSEFFKNK
FDTYVRLENDANAAAFAEYKIGSGKGYKNLVYFTLSTGIGGGIIINGRIYRGFMDSAGEF
GHQIVLPNGPKCRCGSRGCLEAVSSGYAISRDATSKALVRKSGILYEIYKKNGTISAKDV
FYASSQGDDTSWKILNRAIMYLGIGISNIITILSPECVVLGGGLSNQEYIIEEIRNFAKE
HVKMAPINKIKLVKSFFGDDSSLYGSVLDLDIVDSF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatttttacaaaataataaaaataatatacaatattgatatggcagacataaca
caatttgattactatataggcattgatatcggcggcacaagaacaagggtggggcgcttt
tcaaggagttttaaattagaagaaaaggaagttatagaaactttccgctataaagataat
cctaagttgttattggaagagattgcgaaaaaaattttgagtttaaagaaaccaaattca
aagtttgcaatcggcatatccgctcctggtccttgcgatacaaagttgggcatagtaaaa
gatccaccaaatttgcctggttggggtgaggtaagagttagtgaattttttaaaaataaa
tttgatacctatgtacgtcttgaaaacgatgcaaatgctgcggcctttgctgaatacaaa
attggttctggcaagggatataaaaacttagtttattttaccctgtctactggaataggc
gggggaattattattaatggtaggatttacagaggttttatggatagtgcaggagaattt
ggtcaccagatagttcttccaaatggtccaaagtgtaggtgtggaagcaggggatgttta
gaagctgtttcttcaggttatgccatctcaagagatgcaacctctaaggctttggttagg
aaatctggcattctttacgaaatttacaagaagaacggcacaattagtgcaaaagacgtt
ttttatgcatccagtcagggagacgatacatcatggaaaattcttaacagggctattatg
taccttggaattggaattagcaacatcatcacaatactttcccctgaatgcgtagtttta
ggaggcggtctttcgaatcaggaatatattattgaggaaattagaaactttgcgaaagaa
cacgtaaaaatggctccaataaataaaataaagttagtgaaaagtttttttggtgacgat
tcatctctttatgggagcgtgttagatttagatatagtagattctttctaa

DBGET integrated database retrieval system