KEGG   Thermodesulfobium narugense: Thena_1522Help
Entry
Thena_1522        CDS       T01488                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritolkinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
tnr  Thermodesulfobium narugense
Pathway
tnr00900  Terpenoid backbone biosynthesis
tnr01100  Metabolic pathways
tnr01110  Biosynthesis of secondary metabolites
tnr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tnr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Thena_1522
Enzymes [BR:tnr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Thena_1522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N Peptidase_C80
Motif
Other DBs
NCBI-ProteinID: AEE15134
UniProt: M1E9E1
Position
complement(1575043..1575873)
Genome map
AA seq 276 aa AA seqDB search
MFEINAFAKVNLSLDIIGKYPDGYHEIRSVFHSIELFDLLRLELVKEKRLVIDSNAEIKD
NIIHKVWDYMSLNFDIKSGLYLYLGKNIPLKGGLGGGSSDAAAFLYAINLIFSLGLSREE
LVAISMNFGSDIAYFFYGGMCLVEGRGERVFKLDDYLNEEIILVIPNKGISTSFAYDLFD
KNPQVSNYTKQFFDAKKKDIIRPGNVFEDLVLSSDVELKKIKEILNEECEWNLMSGSGSV
FFAKTNKPKQIEKKLSEMGRIVNSRIKPFELRLIEF
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atttttgaaattaatgcatttgctaaagttaacttgagtcttgacataataggcaaatat
ccggatggttatcatgaaataagatcggtgtttcatagtattgaactttttgatttatta
cgcttagaacttgtaaaggagaaaagattagtaattgattctaatgctgaaataaaggat
aacattatccataaagtgtgggattatatgtctttgaattttgatattaaaagtggtcta
tatttatatttaggtaaaaacattcctctaaagggtggtttgggagggggatctagtgat
gctgcagcttttttatatgctattaatttgattttttctttaggattatctagagaagaa
ttagttgctatatcaatgaattttggatccgatatagcctattttttttatggcggaatg
tgcctggtggaaggtaggggggaaagggtttttaaattggatgactatttgaacgaagaa
ataatattagtaattccaaataaaggaatatcaacttcctttgcctatgacttgtttgat
aaaaatcctcaagttagtaattatacaaaacagttttttgatgcgaaaaagaaagatatt
attagacctggcaatgtttttgaagacttagttttgtcctcagatgttgaattgaaaaaa
attaaagaaatcctaaatgaagagtgtgaatggaatttgatgagcggttctggttcagtt
ttttttgctaaaacaaataaaccaaagcagatagaaaaaaaattatctgaaatggggaga
atagttaattcacgcataaagcctttcgagttgagacttattgaattctaa

DBGET integrated database retrieval system