KEGG   Thermococcus nautili: BD01_0554Help
Entry
BD01_0554         CDS       T03065                                 

Definition
(GenBank) 3-polyprenyl-4-hydroxybenzoate decarboxylase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
tnu  Thermococcus nautili
Pathway
tnu00627  Aminobenzoate degradation
tnu01100  Metabolic pathways
tnu01110  Biosynthesis of secondary metabolites
tnu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tnu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    BD01_0554
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BD01_0554
Enzymes [BR:tnu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     BD01_0554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein Glyco_transf_4
Motif
Other DBs
NCBI-ProteinID: AHL22179
UniProt: W8PJ91
Position
483501..484052
Genome map
AA seq 183 aa AA seqDB search
MRVVVAITGASGAVYGIRLVEVLRELGHEVILLATETGIKVARHELGVELKPDYPEDNLF
APTASGSYPFDAMVIAPCSMKTLSAIANGYADNLITRTADVALKERRKLVLLIRETPLNA
IHIENMLRVTRAGAIVMPASPGFYTKPKTVDDIINFIIGKILDILEINNDIYQRWGIPHG
TVG
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgagggtagtggttgcaataaccggtgcgagtggggcagtgtatggaataaggctcgtt
gaggttcttcgagaactcggccatgaagtcattcttcttgcgacggagaccgggataaag
gttgcccgccacgagctcggcgttgaactcaagccggattacccggaagacaatctcttc
gccccaaccgcctcgggttcttacccgtttgacgcgatggtaatcgctccctgctcgatg
aagaccctctcggcgatagccaacggttacgccgacaacctgataaccagaactgcggac
gtcgctctgaaggaaagacgaaagctcgtgctccttatacgggaaactcctctcaacgcc
atccatatcgagaacatgcttcgcgtgactcgcgcgggagcgattgtaatgcccgcctcg
cctggattttacacaaagccgaaaactgtggatgatataataaactttataatcggcaaa
atcttagatattctggaaattaacaacgatatttaccagcgctgggggattccccatggt
acagttggatga

DBGET integrated database retrieval system