KEGG   Thermococcus nautili: BD01_1909Help
Entry
BD01_1909         CDS       T03065                                 

Definition
(GenBank) Phosphate/sulfate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
tnu  Thermococcus nautili
Brite
KEGG Orthology (KO) [BR:tnu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BD01_1909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Ytca
Motif
Other DBs
NCBI-ProteinID: AHL23511
UniProt: W8P3Y2
Position
1673927..1675138
Genome map
AA seq 403 aa AA seqDB search
MDPWLLITILLGFAMAWAIGANDAANSMSTAVGAKAITPKQAVVIAGVLEFTGAYFFGKS
VTETIRKGILDPSRITDPNVLIYGSIAALLAATIWLIIATKFGLPVSTTHSIIGGIAGYG
IVYAGTSIVNWGKMTQVVLSWILSPIVGAIMAYLVFKALTRSIFMSKNPVKNARVWSPFW
IGLAFVVIGTMFYIKVLHGKDLKAGVLFYGIPAGFLVFLITYALIRLRFPINDPYIGVES
IFRRVQVITSGYVALAHGANDVANAIGPVAAVYAVASMGMAGMKVPVPRWILALGGLGIA
VGVATYGYRVMETVGKKITELTNTRGFTIDFSAATVVLFASWLGMPISTTHTVVGAVVGV
GLARGIKAINTSILKDIVISWFVTVPVAGLISAVIFKVLMLVG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggacccctggctgctaatcacaatcctcctgggttttgccatggcttgggcaataggt
gccaacgacgccgccaactcgatgagcacggcagtgggagcgaaggcgataacgccaaag
caggcggtggtcatagccggagtgcttgagttcacgggtgcctacttctttggaaagagc
gttaccgagacgatacggaagggaatccttgacccgagcagaatcaccgaccccaacgtc
ctcatttacggctcaatagcggcccttttagctgcgacgatttggttgataatagcgacc
aagtttggactgcctgtttcaaccactcactcgataatcggcggaatagccggctacggc
atcgtttacgccgggacgagcatcgttaactggggtaagatgactcaggtggtcctcagc
tggattctttccccaatcgtcggcgcaataatggcctacctcgtctttaaggccctcacg
aggagcattttcatgagcaaaaatcccgttaaaaacgcccgtgtgtggtcgccgttctgg
attggactcgccttcgtggtcatagggacgatgttctacatcaaggttctccacggcaaa
gacctgaaggcgggcgttctcttctatggaatccctgcgggtttcctcgttttcctgatt
acctacgctctgatacggctcaggttccccataaacgacccctacataggggttgagagc
atatttcggcgcgttcaggttatcacctctggctacgtggctttagcgcacggtgccaac
gacgtcgcgaacgccataggaccagtcgctgcagtctacgccgtcgcgagtatgggaatg
gcgggaatgaaggttcctgttccgaggtggattttggccctcggaggtctcggcatagcg
gtcggcgtcgccacctacggctaccgcgtcatggagacagttgggaagaagataaccgag
ctgacgaacacgcgcggcttcacgatagacttctcggccgcgacggtcgtcctcttcgcg
agctggctcggaatgccaatctcaaccactcacaccgttgttggtgcggtcgttggcgtc
ggcctggcgaggggaatcaaggcgataaacacttcaatcctgaaggacatagtaatctca
tggttcgttaccgttccggtcgccggcctaatcagcgccgtcatattcaaggtcttaatg
ctcgtggggtga

DBGET integrated database retrieval system