KEGG   Thermosediminibacter oceani: Toce_0124Help
Entry
Toce_0124         CDS       T01289                                 

Definition
(GenBank) LSU ribosomal protein L22P
  KO
K02890  large subunit ribosomal protein L22
Organism
toc  Thermosediminibacter oceani
Pathway
toc03010  Ribosome
Brite
KEGG Orthology (KO) [BR:toc00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Toce_0124
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:toc03011]
    Toce_0124
Ribosome [BR:toc03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Toce_0124
  Bacteria
    Toce_0124
  Archaea
    Toce_0124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF1173
Motif
Other DBs
NCBI-ProteinID: ADL06915
UniProt: D9RZL7
Position
130770..131108
Genome map
AA seq 112 aa AA seqDB search
MEARAQARYVRIAPRKVRIVLDLIRGKKLDEALSILQFTPKRASKIVEKLIRSAAANAEN
NHNMNPDALYVYKCYADQGPTLKRFRARAMGRAAMIRKRTSHITVVLREKEG
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
ttggaagccagggcacaggcaagatacgttagaattgccccgagaaaggtcagaatagtc
ctcgacctcataaggggcaaaaagcttgacgaagcccttagcatactgcagtttactccc
aagagggcttcaaaaatcgtggagaagctcatacgctccgctgcggcaaatgcggaaaac
aaccacaatatgaacccggatgccctttacgtatacaagtgctacgcggaccagggcccc
actcttaaaaggttcagggcgagagccatgggcagggcggctatgatccgcaagaggacc
agccacatcacggtggtattaagggaaaaggagggataa

DBGET integrated database retrieval system