KEGG   Thermosediminibacter oceani: Toce_0214Help
Entry
Toce_0214         CDS       T01289                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
toc  Thermosediminibacter oceani
Pathway
toc00010  Glycolysis / Gluconeogenesis
toc00350  Tyrosine metabolism
toc00625  Chloroalkane and chloroalkene degradation
toc00626  Naphthalene degradation
toc01100  Metabolic pathways
toc01110  Biosynthesis of secondary metabolites
toc01120  Microbial metabolism in diverse environments
toc01130  Biosynthesis of antibiotics
toc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:toc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Toce_0214
  Lipid metabolism
   00071 Fatty acid degradation
    Toce_0214
  Amino acid metabolism
   00350 Tyrosine metabolism
    Toce_0214
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Toce_0214
   00626 Naphthalene degradation
    Toce_0214
Enzymes [BR:toc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Toce_0214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ADL07002
UniProt: D9S074
Position
210888..212039
Genome map
AA seq 383 aa AA seqDB search
MDFQFFVPTRILFGRGRVREAGNYGKGLGKKALVVTGKSSARKSGSLDKLTKSLEENGVE
WVLFDGVEPNPLTTTIDRGAVFARENKVDLVIGLGGGSAMDTAKGIAFAAANDGPIVDYM
EGRTGEKALPLILIPTTSGTGSEANNIAVMTNPVTMVKKGFRNPSIFAVVSIVDPDLTAT
MPRKVTASTGIDAFFHAVESILSLRCQPFTEILSLKAIELIYNNIMKACADGKDSDSREA
MALASTMAGMALGQSGVCLLHGMEHPLSSYYGASHGEGLAPLAGAFLRFVKPFASERLAK
VAKAMGLDVEGLSADEAAQKAVEAVEQMLKELGLPDSISQFGVKEEDIEKLAQHVYKYMG
HNLETTPGSPGYEDIKRMYLESL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
ttggattttcaattttttgttccgacccgaatattgttcggcagggggagggtgcgtgaa
gcaggcaattacggaaaaggtcttggcaagaaagccctggtggttaccggaaagtccagt
gccaggaaatcgggcagcctggataaactcacgaaaagccttgaggaaaacggcgtggag
tgggtgctgttcgacggtgttgaacccaaccccttgaccactactattgacaggggcgct
gtttttgccagggaaaacaaagtggacctggtgataggcctcggcggcggcagcgctatg
gataccgccaagggcatagccttcgcagccgccaatgatgggccgatagtcgattacatg
gaaggcaggaccggagaaaaggcactgccgctgatcctcataccgaccacctcaggcacc
ggcagcgaggccaacaacatagccgttatgacaaacccggtgacgatggtcaagaaaggc
ttcagaaatccgtcgattttcgctgtagtctccattgtggacccagacctgacggccaca
atgccccgaaaagtgacggcttcgacgggtatcgacgcctttttccacgctgtggaatcg
attctgagcctcaggtgccagccctttacggaaattctgtccctgaaggcgatagagctc
atatacaataatataatgaaagcgtgtgcggacgggaaagattcggacagccgcgaggct
atggctctagccagtaccatggctggtatggctttagggcaatccggtgtgtgcttgctt
cacgggatggaacaccccctgagcagctactacggggcatcccacggcgagggactggcg
ccgctggccggggcgtttttgagattcgtgaaaccctttgcatcggaaaggttggcgaag
gtggcaaaggccatgggacttgacgtcgagggactttcggccgacgaagccgcacagaaa
gctgtagaggctgtggagcaaatgctgaaagaactcggcctgccggacagcatttcccag
ttcggagttaaagaagaagacatagaaaaactggcacagcacgtatataaatacatggga
cacaaccttgaaactactccgggtagtccgggatacgaagatataaagcggatgtatcta
gagtcgctgtag

DBGET integrated database retrieval system