KEGG   Thermosediminibacter oceani: Toce_0377Help
Entry
Toce_0377         CDS       T01289                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
toc  Thermosediminibacter oceani
Pathway
toc00360  Phenylalanine metabolism
toc00362  Benzoate degradation
toc00620  Pyruvate metabolism
toc00621  Dioxin degradation
toc00622  Xylene degradation
toc00650  Butanoate metabolism
toc01100  Metabolic pathways
toc01120  Microbial metabolism in diverse environments
toc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:toc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Toce_0377
   00650 Butanoate metabolism
    Toce_0377
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Toce_0377
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Toce_0377
   00622 Xylene degradation
    Toce_0377
   00621 Dioxin degradation
    Toce_0377
Enzymes [BR:toc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Toce_0377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ADL07158
UniProt: D9S0Z4
Position
381002..381877
Genome map
AA seq 291 aa AA seqDB search
MDKIKVAVIGPGNIGSDLMYKILRSEYLCMEMMAGIVESEGIKRARSLGIRTTTEGIKPI
LEDESIKIVFDATGAKHHLKHAPLLKEAGKIAIDLTPAAVGPYVVPPVNLKDLHEEPNLN
MVTCGGQATVPIVYAINQVAGARYAEIVACIASKSAGQGTRQNIDEFTQTTAKALCAIGG
AKKSKAIIILNPADPPIIMTNTIYVDVENPDEKAIREAVDKMVRAVQSYVPGYRLRVPPI
LEGNKVTTIVEVEGAGDFLPKYAGNMDIITSAAVAVAEKLAARIMGKEAVA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaatcaaagttgccgtaataggtccgggcaacatcggttcggatttgatgtac
aaaatcctgcgcagcgaatacctctgtatggaaatgatggctggaatcgtggagtccgag
ggaatcaagagggctcgctccctgggaatccgcaccactaccgagggaataaagcccata
ctggaagatgaaagcataaaaatagtgtttgatgccacaggagccaaacaccacctgaaa
cacgctcccttgctgaaagaagccggtaaaattgccatcgaccttacgccggctgcggtg
gggccctatgtggtaccgccggtcaatctcaaagatttacatgaggagccaaacctcaac
atggtaacctgcggtggtcaggccaccgtgcccatagtttacgccatcaatcaggtggcc
ggcgcccgttatgcggaaatagtggcgtgcatagcgagcaaaagcgccgggcagggcacg
cggcagaacattgacgaatttacccagacgacggcaaaagccctttgtgccatcggcggg
gccaagaagagcaaggccattattattctaaatcctgccgacccacctatcatcatgacc
aacactatatacgtggatgtggaaaacccggacgaaaaagccatacgcgaagccgtcgat
aaaatggtcagggcagtccagagctatgtaccgggttaccggctgcgagtgccgcctatt
ctggagggaaataaagtaactaccatcgtcgaagtagaaggagcgggggatttcctgccc
aaatacgccggcaacatggatattataacgtcggcggcggtggcggtagccgagaaactg
gcggccagaattatggggaaggaggcagtggcgtga

DBGET integrated database retrieval system