KEGG   Thermosediminibacter oceani: Toce_0501Help
Entry
Toce_0501         CDS       T01289                                 

Definition
(GenBank) Undecaprenyl-phosphate galactose phosphotransferase, WbaP
  KO
K00996  undecaprenyl-phosphate galactose phosphotransferase [EC:2.7.8.6]
Organism
toc  Thermosediminibacter oceani
Brite
KEGG Orthology (KO) [BR:toc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:toc01005]
    Toce_0501
Enzymes [BR:toc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.6  undecaprenyl-phosphate galactose phosphotransferase
     Toce_0501
Lipopolysaccharide biosynthesis proteins [BR:toc01005]
 O-antigen
  Toce_0501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_transf CoA_binding_3 PglD_N Shikimate_DH GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ADL07277
UniProt: D9S1K0
Position
505065..506615
Genome map
AA seq 516 aa AA seqDB search
MNNSQVEIRKTGRQIVTQSNEAAIALRPAPTLDLAHAFWGAFEITLLAAMDFLGIATSFM
LALLIRIRTLPALSPLYSSMVPDRLINNFWWLTGIVLGILAFEGLYTARYPFWRELQRLV
KGITLAFLVVFTVIFMAKLSSEVSRTVLTLTYLFCLLILPFCRYTGKTILSRLGLWRRKV
VILGAGKTGELVAKIFSSDSYLGYEVVGFLEDDPGKKHKTFAIKKDTILKVLGNFSDAQE
VMQRLGVRHLVVAAPGMPSQELVKLVNRLQREAASVLVIPDLLGVPVSSAEIDYFFEEQM
LGFRVRNNLSDPVNMVLKRTFDLVVGSIALLVSAPIMAIIALAIKLDSPGPVIFAHKRIG
RWGKEFKCYKFRTMYLNNEEILQRYLASNPAAKEEWEKYAKLKGYDPRVTRVGRFLRKLS
LDELPQIFNVLKGEMSLVGPRPYLPRERFRMDNFAETILLARPGITGLWQISGRNEIDFE
GRLNLESWYVRNWSLWLDIVILIRTVGVVLARRGAY
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgaataacagccaggtggagataagaaaaaccggccgacagatcgtaactcaaagtaat
gaagccgcaattgctttgaggccagccccgacccttgacctggctcacgccttctggggg
gcatttgaaataactttacttgcggctatggattttttggggattgcaaccagctttatg
cttgctctccttatcaggattcgaactttaccggcgcttagcccgctctattcttccatg
gttccggacaggctcataaacaacttctggtggcttacggggatcgttctcggtattctg
gcatttgaaggtttatatactgcgcggtaccctttctggcgggaattacagcgcctggta
aaagggattactctagcttttttagtagtttttaccgtgattttcatggcaaaattgagc
agtgaagtatcgagaacggtattaacgcttacatacttattctgccttctgatattacct
ttttgccggtataccgggaaaactattctgtcccggctcggcctgtggcgccggaaagtg
gtgattctcggtgcgggtaaaacgggcgaactagtagcgaaaattttcagcagcgattcg
tacctgggatacgaagtagtcgggttcttggaagacgatcccggcaaaaagcacaaaact
tttgcaattaaaaaagacaccatactaaaggtcctgggaaattttagcgatgctcaggaa
gtaatgcagcgcctgggggtgcgccacctggtggtagctgcgcctggaatgccctcccag
gaactggtgaaattagtaaaccgcctgcagcgggaagccgcgtccgtgcttgtaattccg
gacctcctcggcgtcccggtaagcagcgccgaaatagactacttcttcgaagagcaaatg
ctgggcttccgtgtacgtaacaatctatcagatcctgttaatatggtcctcaaacgcact
tttgacctggtagtgggcagtattgctttactggtaagtgcgcctattatggctataata
gctcttgctataaaacttgactcgccaggcccggtgatctttgcacacaaaaggatcggc
cgttggggtaaggagtttaagtgctataagtttcggacgatgtacctgaacaacgaggaa
attctgcagcgatatttagcgtcaaaccctgcggcaaaagaagaatgggagaaatacgct
aagcttaaaggttacgatcctcgagttaccagagttgggcgttttctgagaaagctcagc
ctggatgaactgccgcaaatattcaatgtccttaaaggcgagatgagtctagttgggcca
cgaccctatcttccgcgagaaagatttcgcatggataattttgcggaaaccatattactt
gcccgtccaggtattaccggtctttggcagataagtgggagaaacgaaatagattttgaa
ggccgtctgaacctcgaatcctggtacgtgcgcaactggtcactatggcttgatatcgta
atacttatccgcactgtaggtgtcgtgcttgcaaggcgaggggcgtattga

DBGET integrated database retrieval system