KEGG   Thermosediminibacter oceani: Toce_1485
Entry
Toce_1485         CDS       T01289                                 

Definition
(GenBank) D-ornithine 4,5-aminomutase E subunit
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
toc  Thermosediminibacter oceani
Pathway
toc00472  D-Arginine and D-ornithine metabolism
toc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:toc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Toce_1485
Enzymes [BR:toc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Toce_1485
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: ADL08234
UniProt: D9RY10
Position
complement(1454141..1456336)
AA seq 731 aa
MELKKNEKLNIEEILKNLENYRPRRRGWHWREKVENQKIGPFEYRETSKGLKNSIPLPAA
KYFGGIDPQPDYVITTEIASGRFEDDIRRMRMAAWHGADHIMVIRTAGQSHFDGLIEGTP
EGVGGVPITRKQLRATRKALDMIEDEVGRPINFHSYVSGVAGPEVAVLFAEEGVNGAHQD
PQYNVLYRNVNMVRSFVDAAVAKKIMAWADMIQIDGAHNANATAREAWKVMPELMVQHAI
NAMYSLKVGMKKENISLSTVPPTAPPAPCIRLDLPYAVALRELFKGFRMRAQMNTKYIES
STREATVTHVLNLLISRLTGADIQSTITPDEGRNVPWHYFNIQAVDTAKQALVGMDGLTE
MVQIKRDGPLGEKVRELKERAVLFLEEIVEVGGYFKAVEMGFFVDSGFYPERNGDGIVRK
IDGGVGAGTVVKRDKDYLAPVCHHFGYNNLPEGLEHPCDLIGGCTLCNPDKIAYIDELDE
KDNVHVRLEETREIREKGLIKPEVEWFADGIVCMNLFLPVGEEIAEAAGLEIAKRLGLTD
AEIIHREIMHPSEGTYLEIKGKVPFTIDPSSLTIPKKPEILSPEEIINFVKENPVKIVAA
TVGEDEHSVGLREIIDIKHGGLEGFGIECHYLGTSVPVEKVVDAAIEIDADAILISTIIT
HADIHRINMRKLHQLCVEKGIRDRVLLVGGGTQVTDDIARESGLDAGFGRGTKGIHVASF
LVKKLREKKRL
NT seq 2196 nt   +upstreamnt  +downstreamnt
atggaacttaaaaaaaacgaaaagctcaatatagaggaaatactgaaaaaccttgaaaac
taccggccccggaggcggggatggcactggagggagaaggtagaaaatcaaaaaataggc
cccttcgagtaccgggagacttcgaagggcttgaaaaacagcattccgctgcctgcagcc
aagtatttcggcggtatagatccccagcccgattatgtcattaccaccgagatagcctcc
ggcaggttcgaggacgatatacgcaggatgcgcatggcggcctggcacggagccgaccac
attatggttataaggaccgcggggcagagccactttgacggacttatcgaaggtactccc
gaaggtgtgggcggagttcccattacgcgaaaacaactccgggccaccagaaaggccctg
gacatgatagaggacgaggtgggcaggcccatcaattttcactcctatgtgagcggtgtg
gcagggccggaagtggcggtactgtttgccgaagaaggagtcaacggcgcccaccaggac
ccccagtacaacgtgctttacaggaatgtgaatatggtgcgttccttcgtcgacgcggcg
gttgccaaaaagataatggcctgggccgatatgatccaaattgacggggcccataacgcc
aacgctacggccagggaagcatggaaggtcatgcccgagctcatggtccagcacgccata
aacgccatgtattcgctgaaggtgggaatgaagaaggaaaatattagcctttctacggtg
cctccgacggcacctccggcaccatgtataaggcttgacctgccgtacgccgtagccctc
agggagcttttcaagggttttaggatgcgggcccaaatgaatacgaagtacattgagtcc
agcacgagggaggcgacggtaacccatgtgctcaaccttctgatttcccgcctcaccggt
gccgacatccagagcacgattaccccggatgaaggaagaaacgtgccatggcattacttc
aacatacaggcggtggatacggcaaaacaggcccttgtggggatggacggattaaccgag
atggtccagataaaaagagatggcccgctcggtgaaaaagtgagggaactcaaagagagg
gctgtgctgttccttgaagagatcgtggaagtagggggatacttcaaggctgtcgaaatg
ggatttttcgtagactcgggattttatcccgagaggaacggcgacgggattgtgagaaaa
atcgacggcggcgtcggagcgggaaccgtcgttaagcgggataaggactacctggctccg
gtatgccaccacttcgggtacaacaatctgccggagggcctcgagcatccctgcgacttg
ataggagggtgtaccctttgcaatccggacaaaatagcttatatagatgagcttgatgag
aaggacaacgtacacgtaaggttggaagaaacccgggagattcgcgaaaaagggctcata
aaacccgaagttgaatggtttgccgatggaatagtctgcatgaatttattcctgccggtc
ggagaagagatagctgaagctgcgggcttggaaatcgccaagagattggggcttactgac
gcagaaatcatccacagggagataatgcacccgtcggaaggcacgtatctggagataaag
gggaaggtgcctttcacgatagatccgtcgtcgcttacaatccccaagaaaccggagatc
ctttcgccggaggagataataaatttcgtaaaggagaatcccgtaaaaatagttgctgcc
accgtgggtgaggatgagcattcggtaggtctgagggagataatagacatcaaacacggt
ggtctggaaggtttcggaatagaatgtcactatctgggcacatcggtgccggtggaaaag
gtggtagacgcggcgatagaaatagatgcggatgcaatactcatcagcaccatcattacc
catgccgacattcacaggataaacatgaggaaactccaccaactgtgtgtagaaaagggc
atcagagacagggtcctgctggtaggaggtggaactcaggtcaccgatgatatagccagg
gagtcggggctggacgccgggtttggacgcggtacaaagggaatacatgttgccagcttc
ctggttaaaaaattgagggagaaaaagagattgtaa

DBGET integrated database retrieval system