KEGG   Thermosediminibacter oceani: Toce_1486
Entry
Toce_1486         CDS       T01289                                 

Definition
(GenBank) D-ornithine 4,5-aminomutase S subunit
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
toc  Thermosediminibacter oceani
Pathway
toc00472  D-Arginine and D-ornithine metabolism
toc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:toc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Toce_1486
Enzymes [BR:toc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Toce_1486
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A DUF2067
Other DBs
NCBI-ProteinID: ADL08235
UniProt: D9RY11
Position
complement(1456336..1456725)
AA seq 129 aa
MQRKDDFETRRQHLAHLSEEELEKRFWELTEKIVEPLIELARTHTSPSIERSVLLRMGFD
SLTAKAIVEKCVEKGLLGKGAGHVVLKYALYKNIPIKEAGERLAKGDGWDEIEQAMAVKI
SAASAGEVV
NT seq 390 nt   +upstreamnt  +downstreamnt
atgcagcgaaaggatgactttgaaacaaggcgccagcatcttgcgcatcttagcgaagaa
gagctcgaaaaaaggttctgggagctcacggagaaaatagtggaacctctgatagaactg
gcgcgtacccatacttctccgtcgatagagaggtccgtactgctccggatggggttcgac
agcctgactgccaaagcaatagtggaaaaatgcgtagaaaagggcctgctgggaaagggc
gcgggtcacgttgtgctgaaatatgctctctacaaaaacattcccataaaggaagccggg
gaaagactggccaaaggcgatggttgggatgagatcgaacaggcaatggctgtgaaaata
agcgctgcatctgcaggggaggtggtatga

DBGET integrated database retrieval system