KEGG   Thermosediminibacter oceani: Toce_2028Help
Entry
Toce_2028         CDS       T01289                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
toc  Thermosediminibacter oceani
Pathway
toc00010  Glycolysis / Gluconeogenesis
toc00020  Citrate cycle (TCA cycle)
toc00620  Pyruvate metabolism
toc01100  Metabolic pathways
toc01110  Biosynthesis of secondary metabolites
toc01120  Microbial metabolism in diverse environments
toc01130  Biosynthesis of antibiotics
toc01200  Carbon metabolism
Module
toc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:toc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Toce_2028
   00020 Citrate cycle (TCA cycle)
    Toce_2028
   00620 Pyruvate metabolism
    Toce_2028
Enzymes [BR:toc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Toce_2028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl RnfC_N HlyD_3 GCV_H
Motif
Other DBs
NCBI-ProteinID: ADL08749
UniProt: D9RZX2
Position
complement(2039297..2040511)
Genome map
AA seq 404 aa AA seqDB search
MAYMAVYIVMPKLGLTMKEGTLTKWLKKVGDKVSKGEEVAEVSTEKITNVVESPADGIVG
KILVSEGAVVPVATPIGIILAEGEKLPVEDEAGPANTSPSTVAVQADRLETPAVEKNQEK
FIKATPLARKIAKENNVDLSLIAGTGPGGRITEEDVRKYIENKLNVKKDSPAVVEEDTGS
VKKVPMDNMRRVIAERMKNSWNSAPHVTENIKVDVTELVKFREELNKFADEKFTYTDLIA
KACVLAIKRNPVINWSIEGEYIIQHEKINLGIAVALENGLIVPVIKDAGSKSLTEISKMI
KDLSARARENRLSPEEIKDGTFTITNLGMYGIDSFTPIINPPESAILGVNTIYKEPAVVE
DSISIRQVMMLSLSFDHRLIDGATAAKFLMDLKRILENPVMLAL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcgtatatggcggtttatatagtaatgccaaaacttggtctcacaatgaaagaagga
actttaaccaaatggttgaaaaaagttggggataaagtatcaaaaggagaagaggtggct
gaagtttccaccgaaaagatcaccaatgtggttgaatctcctgcagatgggattgtggga
aaaattttggtgagtgaaggcgctgttgtacctgtagctactccgatcggcattatcctg
gctgaaggcgaaaaactcccagtagaagatgaggctggtcccgcaaatacttctccttct
accgtggctgtgcaggctgaccggcttgagacaccggcggtggaaaagaatcaggaaaag
tttataaaagctacgcctttagctagaaagattgcaaaagaaaacaatgtggatctctcc
ctgattgccggtaccggacctggtggcagaattaccgaagaagacgtaaggaaatacata
gaaaataaattgaatgtaaagaaagacagccctgctgtggttgaggaagacacgggatct
gtaaagaaagtgccgatggacaatatgagaagggtcatcgccgaaaggatgaaaaatagc
tggaacagcgctccccatgttacggagaatattaaagttgatgttaccgaacttgttaag
tttagagaagaacttaataaatttgctgatgagaaatttacctacaccgacttaatagct
aaagcatgtgtgcttgcaatcaaaagaaatcccgtaatcaattggtctattgaaggagag
tatataatccagcacgaaaagataaatctcggaatagcagtcgctctagaaaatgggtta
atagttccggtgataaaggatgccgggtcaaaatccctcacggagatctctaagatgata
aaagacctgagtgctagggccagggaaaacagattatctcccgaggaaataaaagatggc
acgtttaccataacgaatctcggcatgtacggtatagatagctttacacctattataaat
ccgccggaaagcgctatattgggagttaacacaatatacaaagaacctgcagtggtcgaa
gatagtatctctataagacaggttatgatgctgagcctgtccttcgaccacaggcttatt
gatggcgcgaccgctgctaaattcctgatggatcttaagcgcatactagaaaatcctgta
atgctagctttatag

DBGET integrated database retrieval system